(data stored in ACNUC7421 zone)

EMBL: CP002047.PE536

CP002047.PE536       Location/Qualifiers
FT   CDS_pept        complement(633081..633851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00536"
FT                   /product="von Willebrand factor type A"
FT                   /note="COG4245 Uncharacterized protein encoded in toxicity
FT                   protection region of plasmid R478, contains von Willebrand
FT                   factor (vWF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03657"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G6"
FT                   /protein_id="ADI03657.1"
FT                   /translation="MSVHSIEFGAGFEERQPVVLLLDTSASMGRPEEHPRIDELNGALT
FT                   RWFDGVRGQERLRNRVEVCLITFDSAVRVHDPGPGRLVPVEEADADRVFVPVDSMRPPT
FT                   LRAEGLTRLTEAVEAALELVRTRYRTLQRQRVPVRRPFLWVLTDGAPSDAQGRPLDATA
FT                   LAGTAGRVLEGEEQGEWVFQVIGVRGADLPMLRVLAPKATSALENLDFGRILDLLFQST
FT                   DDSSPDRTADLIHQDIDDRAARLARMERLERDLR"
     atgagcgtcc atagcatcga gttcggggcc gggttcgagg agcggcagcc cgtcgtcctc        60
     ctcctcgaca cctccgcgtc catgggccgc cccgaggaac acccgcggat cgacgagctg       120
     aacggcgcgc tgacccgctg gttcgacggg gtccgcgggc aggagcggct gcgcaaccgg       180
     gtggaggtct gcctcatcac cttcgactcg gcggtgcgtg ttcacgaccc cggtccgggc       240
     cgcctggtcc cggtcgagga agccgacgcc gaccgggtct tcgtcccggt ggacagcatg       300
     cgcccgccca cgctgcgcgc cgaaggcctg acccggctga cggaagccgt ggaagcggcc       360
     ctcgaactgg tccgcacccg ctaccgcacc ctgcaacggc aacgggtgcc ggtccggcgt       420
     ccctttctgt gggtcctgac ggacggcgca ccgagcgacg cccagggccg cccgctggac       480
     gcgacggctc tggcgggtac ggcggggcgg gtgctcgagg gcgaggagca aggggagtgg       540
     gtcttccagg tgatcggggt acgcggcgcc gacctgccga tgctccgggt actggcgccg       600
     aaggccacgt ccgcgttgga gaacctggac ttcggccgga tcctcgacct gctcttccag       660
     agcacggacg acagcagccc ggaccggacc gcggacctca tccaccagga catcgacgac       720
     cgcgccgccc ggctcgcccg catggagagg ctggagaggg acctccggtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page