(data stored in ACNUC7421 zone)

EMBL: CP002047.PE538

CP002047.PE538       Location/Qualifiers
FT   CDS_pept        complement(634221..635291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03659"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0G8"
FT                   /protein_id="ADI03659.1"
FT                   /translation="MQEVRRAGLLRLRGRELPALESAAASSATARTREGAVEALLRHAV
FT                   ERLDAGTLRTAAEYTLGLAQGTRDWPASSRRARAAEVYRVSEERFRKHHEVMVLGQVAE
FT                   HIVELVELTRGGDDEPGEGDWEGDTHRFVDVLAGDRTVRLTLHIHPVDLLRDVDVVVSP
FT                   ANTYFALPEPYKSSVSASLRRAASVRGVTGDLLDDPVHEELRIWAARQGTSGRPVVPGT
FT                   VAATGSGAMAEYGVRRIYHAAVAVPRAGTNDYDVLPADVTRATSRAIALLAEERDRHTP
FT                   PLRSVCFPLLGSGRGGLPYRVSAAAVWSAVEAELARGARWDVHFVVRTPEAARVVERIP
FT                   ARTRPGRDQSAPGRSV"
     ttgcaggagg tccgacgggc ggggctgctc aggctgcgcg gtcgggagct gcccgccctg        60
     gagtcggccg cggcctcttc ggcgaccgcg cgcacccgcg agggtgccgt ggaggcgctg       120
     ctccgccacg cggtggagcg gcttgacgcg ggcacgttgc ggaccgccgc cgagtacacg       180
     ctgggcctgg cccagggcac ccgggactgg ccggcgtcct cccgccgggc ccgcgcggcc       240
     gaggtgtacc gggtgagcga ggaacgcttc cgcaagcacc acgaggtgat ggtgctcggc       300
     caggtggccg agcacatcgt ggaactggtg gaattgacga ggggcggcga cgacgagccg       360
     ggcgagggcg actgggaggg tgacacccac cggttcgtgg acgtcctggc gggcgatcgg       420
     accgtacgcc tcaccctcca catccacccc gtcgacctgc tgcgggacgt ggacgtggtg       480
     gtctccccgg ccaacaccta cttcgcgctg cccgagccgt acaagtcctc ggtctccgcc       540
     tcgttgcgcc gggccgcctc cgtgcgcggg gtgaccggcg acctgctcga cgacccggtc       600
     cacgaagagc tgcgcatatg ggcggcgcgg cagggcactt cggggcggcc ggtggttccg       660
     ggcacggtgg cggcgaccgg ttcgggggcc atggccgagt acggcgtacg gcggatctac       720
     cacgcggcgg tggccgtgcc ccgggccggc accaacgact acgacgtgct gcccgccgac       780
     gtcacccgcg ccacctcgcg cgcgatcgcg ctgctggccg aggagcgcga ccggcacacc       840
     ccgccgctgc gctcggtgtg cttcccgctg ctcggctccg ggcgcggcgg gcttccgtac       900
     cgggtgagcg cggcggccgt gtggagcgcc gtcgaggcgg aactggcgcg cggggcgcgc       960
     tgggacgtgc acttcgtggt acgcaccccg gaggcggccc gcgtggtgga gcggatcccg      1020
     gccaggaccc gcccggggcg cgaccagtct gcgcccggcc gatccgtttg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page