(data stored in ACNUC7421 zone)

EMBL: CP002047.PE540

CP002047.PE540       Location/Qualifiers
FT   CDS_pept        complement(636085..636777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03661"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H0"
FT                   /protein_id="ADI03661.1"
FT                   /translation="MTSGEDSGTRVLGLIGEHLDSIRAQLTDEQYQLLLTRLRALADTP
FT                   PDDSRAVRRAFQAVRLCLVPLPFDHPVREALDSVRLVATAPVSRPVVLRTRDLLARLTA
FT                   EPPRPPDTAAVIAAVERRLLRTPALSAAEVRGRYRGSAPPPELIRLADPDLGDRYPEFQ
FT                   FRPGGGAPYEVVLEVNRVLLADADPWGAADWWLSGNAWLGGGPPVALLGVRPDRELVGA
FT                   AVALVEGD"
     atgacctcgg gtgaggacag cgggacgagg gtgctcggcc tcatcggcga acacctcgac        60
     agcatccgcg cccagctgac cgatgagcag taccagctcc tgctcacccg gctgcgcgcg       120
     ctcgccgaca ccccgccgga cgactccagg gccgtacgcc gggccttcca ggccgtacgc       180
     ctctgcctgg tgccgctgcc gttcgaccat ccggtccgcg aggcgctgga ctccgtccgg       240
     ctcgtcgcca cggcacctgt cagccgcccg gtcgtcctgc ggacgcggga tctgctggcc       300
     cggctcacgg ccgagccgcc acggcccccc gacaccgcgg ccgtcatcgc cgccgtcgag       360
     cgcagactgc tccgcacgcc cgccctctcg gccgccgagg tccgcggccg gtaccgcggt       420
     tcggcgccgc cacccgagct gatccggttg gccgaccccg acctcggcga ccgctacccg       480
     gagttccagt tcaggcccgg gggcggagca ccgtacgagg tggtcctgga ggtcaaccgg       540
     gtgctgctcg ccgacgcgga tccgtgggga gccgccgact ggtggctgag cggcaacgcg       600
     tggctgggcg gcgggccgcc cgtcgccctg ctcggcgtcc ggccggaccg cgaactggtg       660
     ggcgcggccg tcgcgttggt ggagggggac tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page