(data stored in ACNUC7421 zone)

EMBL: CP002047.PE541

CP002047.PE541       Location/Qualifiers
FT   CDS_pept        complement(636774..640142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00541"
FT                   /product="hypothetical protein"
FT                   /note="COG4995 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03662"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H1"
FT                   /protein_id="ADI03662.1"
FT                   /translation="MGDEGESGGVQAVRTWAGEAIGRARALLPAPGTVAKASRAHDDSV
FT                   TELDALSRLLDHDPELRASVTLWLGGALTLRHGVGGGTPEDRERAHGLLRDVRDPATKT
FT                   GAAASIEDRRWAALFLLTHAMPLQEMLGGLSPEPDATAMFDMIRREGPSGMVAFAAELQ
FT                   ELVTEAAELPLPPENLRQLRQVRDLYTRPSADGIADLFTSLIPDDGFPGNDQLRRTMTD
FT                   WLTTMTGGAGPKSGTAPGTGSDSTGDTRATPDSSDKADAPHPSDEAPAGAPAMPRTPDD
FT                   IRRLIAAWQAVNTTSVDFVDQAGGGDPAALNQQLGRLRDALDGLPDGMPNKDALEGLMA
FT                   LLLSVSDGAGGTLQDQALGLAHTATITDYLRRQSESSIPMADGFALMADVMGLLTEVRT
FT                   AGQAEDEERLRDLLPKAEALADTVPEDHDFRFIALIARAMARLMLGRLTMDRDLLLRGL
FT                   ADFEDGRTAARNSSLPIGHEELEALVPDLATLRSYLTDDTTTIIPDQDVPPPDAPADQL
FT                   HTAANRLGMRYGFTKDPADLEAVITTLEGLREHIRQGRAPRVAAESLWSLADSYRARWH
FT                   REQSESDADAATDAANEALVTLAADVLLQHGAEHRLTTARNGASLGVRAALWAATHGRV
FT                   ADAVAALELGRALVLQAAATSRTVPDLLEERGHPELAAAWRGSGAADSTELPGELPSTL
FT                   RRQALDALGYRERGGLLGTPTFRELADGVAQAGADALIYLVPGSEGDGEAPGMLLAVGP
FT                   EIGIGVGALPMLSEAGSAPLERYLDAADARSRKRDEETERAWEEALSELCDWAYEVFVH
FT                   VLAGLEEHLPGDAADRRTPRVVLVPCGRLGIVPWHAARFPTGAPYDYLCQALVISYAAS
FT                   GSQFLRTVKRAPRDPIAAPAMVADPSLSLMYAEQEVLELRNAFYPGARLYGDFGTLPPD
FT                   SVPTGTPDQLLALLAQDHSMVHLATHGLAGVRPTESALHLAPTDPGEEIGRLTVTRLLD
FT                   RPQAAEEAASDGPLIVLSACQTDLSTRDHDEALTLTTAFVSGGARDVVGSRWTALDSAT
FT                   TLLMAVFHHHLRAGLSPVDALRAAQLWMLDPDRKDPGCLSDTVRHDVRRPDLQRPALWA
FT                   AFIHQGHPGQGKETV"
     gtgggggacg agggggagag cggtggcgtt caggcggtgc ggacctgggc cggcgaggcc        60
     atcggacggg cgagggcatt gctcccggcg ccgggcacgg tcgccaaggc ctcgcgcgcc       120
     catgacgact cggtcaccga gctcgacgcg ctctcccgac tgttggacca cgatccggag       180
     ctgcgcgcct cggtgaccct atggctcggc ggtgccctca ccctgcgcca cggcgtcggg       240
     ggcgggacgc ccgaggaccg ggagcgggcg cacggtctgc tgcgggacgt acgggacccg       300
     gcgacgaaga ccggagccgc ggcctccatc gaggaccggc ggtgggccgc gctgttcctg       360
     ctgacgcacg cgatgccgct gcaggagatg ctgggcggac tctcgccgga gccggacgcg       420
     accgcaatgt tcgacatgat caggcgggag gggccgagcg ggatggttgc cttcgcggcc       480
     gagctgcaag agctggtgac cgaggcggcc gaactcccgc tgccgccgga gaacctgagg       540
     cagctgcggc aggtgcgcga cctctatacc cgtccctcgg ccgacgggat cgccgacctg       600
     ttcacgagcc tcatccccga cgacggtttt ccgggcaacg atcagctgcg gcggacgatg       660
     acggactggc tgacgacgat gaccggtggc gcgggcccga agagcggcac agcccctggc       720
     acgggctcgg acagcacggg tgatacgcgc gccactccgg actcctccga caaggccgac       780
     gccccgcacc cctcggacga ggcccccgcc ggcgccccgg ccatgccccg tacccccgac       840
     gatatccgcc ggctcatcgc cgcgtggcag gccgtcaaca ccacgtccgt ggacttcgtg       900
     gaccaggccg gcggtggaga ccccgctgcc ctcaatcagc agctcgggcg gttgcgcgac       960
     gcgctggacg gactgccgga cggcatgccg aacaaggacg ctctcgaagg gctgatggcc      1020
     ttgctgctca gcgtgagcga cggcgccggc ggcacccttc aggaccaggc gctcggtctt      1080
     gcgcacaccg cgacgatcac cgactactta cggcgccagt cggagagctc gatccccatg      1140
     gccgacggct tcgcgctcat ggcggatgtg atgggcctgc tgaccgaggt ccgcaccgcc      1200
     gggcaggccg aggacgagga acggctccgc gacctcctgc ccaaggccga ggccctggcc      1260
     gacaccgtcc ccgaggacca cgacttccgc ttcatagccc tcatcgcccg cgccatggcc      1320
     cgcctcatgc tcggccggct caccatggac agggatctgc tcctgcgcgg cctcgcggac      1380
     ttcgaggacg gcaggacggc cgcgcggaac agcagcctcc cgatcgggca cgaggagctg      1440
     gaggccctgg ttcccgacct tgcgaccctg cgttcctacc tcaccgacga cacgacgacg      1500
     atcatcccgg accaggacgt accaccaccg gacgcccccg ccgatcagct gcacaccgcc      1560
     gcgaaccggc tcggcatgcg ctacggcttc accaaggacc cggcggacct cgaggccgtc      1620
     atcaccacgc tggaagggct ccgcgagcac atccggcagg gccgggcccc gcgcgtcgcg      1680
     gccgagtccc tgtggtcgct cgccgactcc tatcgcgccc gctggcaccg ggagcagagc      1740
     gagtccgacg cggacgcggc caccgacgcg gcgaacgagg ccctggtcac cctggccgcg      1800
     gacgtcctcc ttcagcacgg cgccgaacac cgcctgacca ccgcccgcaa cggcgcctcc      1860
     ctcggcgtac gggccgccct gtgggccgcc acgcacggaa gggtggccga cgcggtcgcc      1920
     gccctggagc tgggcagggc gctggtgctg caggcggcgg ccacctcccg gaccgtaccg      1980
     gacctgctgg aggagcgcgg ccatcccgaa ctcgccgccg cctggcgggg gtccggcgcc      2040
     gccgacagca ccgagctgcc gggcgagctc cccagcaccc tgcgccggca ggctctggac      2100
     gccctcggct accgggagcg gggcggcctg ctgggcaccc ccaccttccg cgaactggcg      2160
     gacggcgtgg cgcaggccgg tgcggacgcg ctgatctatc tggtccccgg cagcgaaggt      2220
     gacggcgagg ccccgggcat gttgctggcc gtaggccccg agatcggcat cggcgtgggc      2280
     gcgctgccca tgctgtcgga agcgggcagc gcccctctgg agcggtatct ggacgcggct      2340
     gacgcccgct cccggaaacg ggacgaagag acggaacggg cctgggagga ggccctgtcc      2400
     gagctgtgcg actgggcgta cgaggtcttc gtccatgtcc tcgccgggct ggaggaacat      2460
     ctcccgggcg acgcggccga ccgccgtacg ccccgggtcg tcctggtccc ctgcggccgc      2520
     ctcgggatcg tcccctggca cgcggcccgc ttccccacag gcgccccgta cgactacctc      2580
     tgccaggccc tggtgatcag ctacgcggcc tccggcagcc agttcctgcg tacggtgaaa      2640
     cgcgcgccac gcgatccgat cgcggccccg gccatggtgg ccgacccgag cctctcgctg      2700
     atgtatgccg agcaggaggt cctggagctg cgcaacgcct tctatccggg ggcgcggctg      2760
     tacggcgact tcggcaccct cccgcccgac tcggtgccga ccggcacccc cgaccagctg      2820
     ctggccctcc ttgcccagga ccactcgatg gtccatctgg ccacccacgg gctggcgggg      2880
     gtacggccga cggagtcggc cctgcacctg gctcccaccg accccggcga ggagatcggc      2940
     cggctcaccg tgacgcggct cctcgaccgg ccgcaggccg ccgaagaggc ggcgtcggac      3000
     ggcccgctga tcgtcctgag cgcctgccag accgatctga gcacccgtga ccacgacgag      3060
     gccctgaccc tcaccacggc gttcgtctcg ggcggcgcgc gtgatgtcgt ggggtcgcgg      3120
     tggaccgccc tggacagcgc gacgaccctg ctgatggcgg tcttccacca ccatctgcgg      3180
     gccgggctca gccccgtcga cgcactgcgg gccgcgcagc tgtggatgct cgaccccgat      3240
     cggaaggacc cgggctgtct gagcgacacg gtacggcacg acgtccgccg ccccgacctc      3300
     cagcggcccg ccctctgggc cgcgttcatc caccaaggcc accccggcca gggaaaggag      3360
     accgtatga                                                              3369
//

If you have problems or comments...

PBIL Back to PBIL home page