(data stored in ACNUC7421 zone)

EMBL: CP002047.PE542

CP002047.PE542       Location/Qualifiers
FT   CDS_pept        complement(640252..640860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03663"
FT                   /db_xref="GOA:D7C0H2"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H2"
FT                   /protein_id="ADI03663.1"
FT                   /translation="MDVTGAGAPIVAVVGVVGTLLSALLTQRAAERGRQREQERTERVR
FT                   ARAREAEARRTCYVALNASLRQYLAALTDQLHALLRTEDPRAARQRLSEARDLHRDVYA
FT                   EAQMRLPDPVLALAGEVTHALGTLYGRLRRLDDGVPRPGDSLDAAQGEIDALWNRLREL
FT                   RRGMRADLGASGVSRPSPPEPDAHRPRTDPDASRVSSGC"
     ttggacgtca cgggtgcggg tgcgccgatc gtggcggtgg tcggggtggt cgggaccttg        60
     ctgtcggccc tgctgaccca gcgtgcggcc gagcgcggtc gccagcgtga gcaggagcgg       120
     accgagcgag tgcgggcgcg ggcgagggaa gccgaggcgc ggcgtacctg ttacgtcgcc       180
     ctcaacgcct ctctccggca gtatctggcc gccctcaccg accagttgca cgccctgctc       240
     cgcacggagg atccgcgcgc ggcacggcaa cgcctcagcg aggcccggga tctgcaccgg       300
     gacgtgtacg cggaggcgca gatgcggctg cccgaccccg tactcgccct ggccggcgag       360
     gtcacccacg cgctcggcac cctctacggc cgactccggc gcctggacga cggcgtcccc       420
     cgcccgggcg actcgctcga tgccgcccag ggggagatcg acgcactgtg gaaccggctg       480
     cgggagctgc ggcgcgggat gcgtgcggat ctgggagctt cgggggtgtc ccgaccgagc       540
     ccgcccgagc ccgacgcgca ccgtccccga accgatccgg atgcgtcccg ggtgagttcc       600
     gggtgttga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page