(data stored in ACNUC7421 zone)

EMBL: CP002047.PE544

CP002047.PE544       Location/Qualifiers
FT   CDS_pept        641213..641839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03665"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H4"
FT                   /protein_id="ADI03665.1"
FT                   /translation="MTTQLRRALPLLLLPLALTLSACGEESVDRSELESRARALGTEPE
FT                   MVYVTDVPGYTLAPQSVGVIGDHGFGGSYTKPGGGTIELRVDERGSSPAGCAESGPDQA
FT                   RGEKQTCERDGESWYRASKSAHEYAREEDGRVIRLSADRESVTRDTLRQAAESLHQADD
FT                   GELAEVLPKGAGDSGGQVGTERGDLPRTGDGAPQDPAGTTEGTSG"
     atgacgacgc agctacgaag agccctgccg ctgctcctgc tgccgctggc gttgacgctg        60
     tcggcgtgcg gggaggagtc ggtggaccgc tccgaactgg agtcccgggc ccgggcgctg       120
     ggcaccgaac cggagatggt gtacgtgacc gacgtacccg gctacaccct cgcgccgcag       180
     tccgtgggcg tgatcggcga ccacggcttc gggggctctt acaccaaacc cggcggcggg       240
     acgatcgaac tacgggtgga cgagcgcggg tccagccccg ccggctgcgc ggagtccggc       300
     ccggaccagg cccggggcga gaagcagaca tgtgagcggg acggcgagag ctggtatcgc       360
     gcctcgaagt ccgcccatga gtacgcgcgc gaggaggacg gacgagtcat ccggctgagc       420
     gccgaccggg agagcgtcac ccgcgacacc ctccgccagg ccgcggaaag cctccatcag       480
     gccgacgacg gggagctggc cgaggtcctg ccaaagggcg cgggcgacag cggcgggcag       540
     gtcggcaccg agcgcggcga tctgccgagg accggcgacg gcgcgcccca ggacccggcc       600
     ggtacgaccg aggggaccag cggctga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page