(data stored in ACNUC7421 zone)

EMBL: CP002047.PE545

CP002047.PE545       Location/Qualifiers
FT   CDS_pept        complement(641860..642273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03666"
FT                   /db_xref="GOA:D7C0H5"
FT                   /db_xref="InterPro:IPR025597"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H5"
FT                   /protein_id="ADI03666.1"
FT                   /translation="MARALRVLAQLMGWACVAIGLFHVALGNAAIPGAGSAGATVDSWG
FT                   RFMGAVFAGYGLAWLWAARQRPIPARAVRWLAGVFLLGGVGRLLSLAVHGWPQWFQIAL
FT                   AAIELSLPPVFFWLADAEERTLRGDVEALPAGR"
     atggccaggg ctctgcgcgt actcgcgcag ctgatgggct gggcctgcgt ggcgatcggc        60
     ctgttccacg tggcactcgg caacgcggcg atccccggcg ccggttccgc cggcgcgaca       120
     gtcgacagct ggggccggtt catgggggcc gtcttcgccg gttacgggct ggcctggctc       180
     tgggccgcgc ggcagcgtcc gatcccggct cgggcggtgc ggtggctggc cggcgttttt       240
     ctgctgggtg gcgtgggccg gctgctctcg ctcgccgtgc acggctggcc gcagtggttc       300
     cagatcgcac tggcggcgat cgagctcagc ctgccgccgg tcttcttctg gctggccgac       360
     gcggaggagc ggaccctgcg cggcgacgtg gaggccctgc ccgccgggcg atga             414
//

If you have problems or comments...

PBIL Back to PBIL home page