(data stored in ACNUC7421 zone)

EMBL: CP002047.PE546

CP002047.PE546       Location/Qualifiers
FT   CDS_pept        642364..643023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00546"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03667"
FT                   /db_xref="GOA:D7C0H6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H6"
FT                   /protein_id="ADI03667.1"
FT                   /translation="MPPRQRLTPADRRAQLLAVGARLFAAHPYADVLMEDVAEQAGVSR
FT                   ALLYRHFPSKHALFAAVYQQAADQLLAETRLDPADSLVEQLIQGMDVHLDYFVANRNAV
FT                   LAANRVLAGDPVIQTIMTNELDALRARLLAVLPLADAGARDAVSGVLKSWLVFVQVLCV
FT                   DWLSHETCTRTQLRDICIGAVLGALRPLLTEDPAPDWPPQADGAKIGTGRHSKCAG"
     gtgcctcctc gccagcgact cacccccgcc gaccgccgcg cccaactcct cgccgtcggc        60
     gcacggctct tcgccgcgca cccctacgcc gatgtgctga tggaggatgt ggccgaacag       120
     gccggcgtgt cccgggccct gctctaccgt cacttcccca gcaagcacgc cctgttcgcg       180
     gccgtctacc agcaggcggc ggaccaactg ctcgccgaga cgcggctcga ccctgccgac       240
     tccctggtgg agcagctcat ccagggcatg gacgtccatc tcgactactt cgtggcgaac       300
     cgcaacgccg tcctcgccgc gaaccgggtc ctggcgggcg acccggtgat ccagacgatc       360
     atgacgaacg agctggacgc gctccgcgcc cggctgctgg ccgtactccc actcgcggac       420
     gccggcgccc gtgatgccgt atccggcgtc ctgaagagct ggctggtctt cgtccaggtc       480
     ctctgcgtcg actggctcag ccacgagacc tgcacccgca cccagttgcg cgacatctgc       540
     atcggcgcgg tcctcggcgc cctccggccg ctgctcaccg aggaccccgc ccccgactgg       600
     ccgccacaag ccgacggggc gaagatcggt actggacggc actcgaagtg cgcgggctag       660
//

If you have problems or comments...

PBIL Back to PBIL home page