(data stored in ACNUC7421 zone)

EMBL: CP002047.PE547

CP002047.PE547       Location/Qualifiers
FT   CDS_pept        643053..644183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00547"
FT                   /product="regulatory protein DeoR"
FT                   /note="COG1609 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03668"
FT                   /db_xref="GOA:D7C0H7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H7"
FT                   /protein_id="ADI03668.1"
FT                   /translation="MSDMLVAQRHELLVRELEAAEGLKVTELAARLNVSRATIRRDLLE
FT                   LEAEGRVTRVRGGAVLATSRTDGQPSEPRPVAAPSGPLRADARPASAHTLGLLVPSAHY
FT                   YYPRVVAGVQAVATERGVRVVIGLSNYTYPNDTQQIEELVASGATGLLVASATGHILPQ
FT                   EPFERLRAGGLPFVLMERRPYDRYVPGEFVATDHQQGAFGAVGHFMNLGHERVGLFTNG
FT                   SPTAPLLREGYEAAVRQLGLASGAPVLDSGRPTLGPTEATRLYDRFIKECLADGARAAL
FT                   VHSDHDAIELMRRMRSQGLRTPDDIALIAYDDEIASLADVPLTAVAPPKHEIGAQAARL
FT                   LLERLDAPDPSAVPVRQLLIQPRLIVRSSCGAAARA"
     gtgtccgaca tgctcgttgc gcagcggcat gagctactgg tcagggagct ggaggcagcc        60
     gaggggctga aggtcaccga actcgccgcg cgcctgaacg tgtcgcgcgc caccatccgg       120
     cgggatctgc tcgagctgga ggccgaaggg cgggtgaccc gggtccgcgg aggtgccgtg       180
     ctcgcgacat cgcgcaccga cgggcagccg tccgagccgc ggccggtggc cgcgccgtcc       240
     ggccctctcc gcgccgatgc caggccggct tcggcgcata cgctcggatt gctggtcccg       300
     tcggcgcact actactaccc ccgagtcgtc gccggcgtgc aggccgtggc caccgagcgc       360
     ggcgtccgcg tcgtcatcgg cctgagcaac tacacgtacc cgaatgacac ccagcagatc       420
     gaggagctgg tcgcgtccgg cgccaccggg ctgctggtgg cctccgccac gggccacatc       480
     ctgcctcagg aaccgttcga acggcttcgg gccggcgggc tgccattcgt gctgatggaa       540
     cgacggccgt acgaccgcta tgtgccgggc gagttcgtgg ccaccgatca ccagcagggc       600
     gcgttcggtg cggtcgggca cttcatgaac ctggggcacg agcgggtggg gctgttcacc       660
     aacggcagcc ccaccgcgcc tctgctccgc gaggggtacg aagcggccgt ccggcagctg       720
     ggcctcgcct ccggtgcgcc ggtcctggac agcggacgcc ccacgctggg ccccacggag       780
     gccacccgcc tctacgaccg gttcatcaag gagtgcctgg ccgacggcgc ccgggccgcg       840
     ctggtgcact ccgatcacga cgcgatcgag ctgatgcggc ggatgcgctc ccagggcctg       900
     cgtacgccgg acgacatcgc gctgatcgcc tacgacgacg agatcgcctc cctggccgac       960
     gtgcccctga ccgcggtggc gccgcccaag cacgagatcg gcgcccaggc cgcgcggctg      1020
     ctgctggaac gcctcgacgc gcccgacccg tcagccgtac ccgtccgcca gttgctcatc      1080
     cagccccggc tgatcgtcag gtcctcctgc ggggccgctg cccgggcctg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page