(data stored in ACNUC7421 zone)

EMBL: CP002047.PE548

CP002047.PE548       Location/Qualifiers
FT   CDS_pept        644441..645460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00548"
FT                   /product="glycosyl hydrolase 53 domain protein"
FT                   /note="COG3867 Arabinogalactan endo-1,4-beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03669"
FT                   /db_xref="GOA:D7C0H8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011683"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0H8"
FT                   /protein_id="ADI03669.1"
FT                   /translation="MRRRTVLLGAAAGAGTVALGAAAAPAQAEAQAQAAAFVRGADISW
FT                   MPQMEAHGYYWNNSAGVRQDLFAILKGYGITAVSLRTWVNPSSDPANGHCGIEETAQLA
FT                   QRAKNAGMQVLIGFHFGDTWNSAGVQNPPAAWAAMNYSQMLDAMYDYVYHSCNVIKYYG
FT                   VTPAWVKIGNETNSGICKPVGSLSRPDQMTGLLNAAYDMSKKVFPSTPVLVHLAQPQNL
FT                   SGVQNFLNAYRDNGGKWDITGLSSYAQGGNVPGVLANMQTIQAGYGKPVMQVEYGGPVG
FT                   KPAQVRDSLRAFITGLQGFGGLGTFFWEPEGYPSFNSYNSSAWDDSSRRPTAAMDGFI"
     gtgcgccgcc gaaccgtact gctgggcgcc gcggccggtg ccggaacggt ggcgctcgga        60
     gccgccgccg cccccgcgca ggcggaggct caggcgcagg ccgcagcgtt cgtccggggc       120
     gctgacatca gctggatgcc gcagatggag gcacacggct actactggaa caacagcgcg       180
     ggagtgcggc aggatctgtt cgccatcctc aaggggtacg gcatcaccgc ggtcagcctg       240
     cggacctggg tcaacccctc cagcgatccg gccaacggac actgcggcat cgaggagacc       300
     gcacagctgg cccagcgggc caagaacgcc ggtatgcagg tcctcatcgg attccacttc       360
     ggcgacacct ggaactcggc cggtgtgcag aacccgccgg ccgcctgggc cgccatgaac       420
     tacagccaga tgctcgacgc catgtacgac tacgtctacc actcgtgcaa cgtcatcaag       480
     tactacggcg tcacccccgc ctgggtgaag atcggcaacg aaaccaactc cgggatctgc       540
     aaaccggtcg gcagtctcag ccgcccggat cagatgacag gcctgctcaa cgccgcgtac       600
     gacatgtcca aaaaggtctt cccgagtacc ccggtgctgg tgcatctggc ccagccgcag       660
     aacctgagcg gcgtccagaa tttcctgaac gcctaccggg acaacggcgg gaagtgggat       720
     atcaccggcc tttcctcgta tgcgcagggc ggcaacgtgc ccggcgtact ggccaatatg       780
     cagaccatcc aggccggcta cggcaagccg gtcatgcagg tggagtacgg cgggccggtg       840
     ggcaaacccg cccaggtgcg cgattcgctg cgggcgttca tcaccgggct gcagggcttt       900
     ggcggcctgg gcaccttctt ctgggaaccc gagggctacc cctcattcaa cagctacaac       960
     agttcggcct gggacgacag cagtcggcgc ccgacggcgg ccatggacgg cttcatctga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page