(data stored in ACNUC7421 zone)

EMBL: CP002047.PE55

CP002047.PE55        Location/Qualifiers
FT   CDS_pept        51462..51962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03176"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI5"
FT                   /protein_id="ADI03176.1"
FT                   /translation="MPSATRHNRRSDTPPPRTGSSEVEVLRTLLDYLRTSISAKVDGAP
FT                   EPQVRAAAVPSGTNLLGLLNHLTFVERSMFLGDDVTDWQATFQAAPADSVADIVARYRE
FT                   TVERANDVLDGCTDLGAPVPRPRPGRPAPSVRWALTHMIEETGRHAGQADILRELIDGS
FT                   TGR"
     ttgcccagcg ccacgcgcca caaccgccgc agcgacaccc cgccgccccg gaccggaagc        60
     agcgaagtcg aggtcctgcg cacactcctc gactacctcc ggacctcgat ctccgcgaag       120
     gtcgacggtg cccccgagcc gcaggtgcga gccgccgcag tgccgtcggg cacgaacctg       180
     ctcggcctgc tcaaccacct gactttcgtc gagcgctcga tgttcctcgg ggacgacgtc       240
     accgactggc aggcgacgtt ccaggccgca ccggcggaca gcgtggccga tatcgtggcc       300
     cgctaccgag agacggtcga gcgcgcgaac gacgttctcg acgggtgcac cgatctcggc       360
     gccccggtcc cccgaccgcg gccggggcgc cccgctccca gcgtccgctg ggcactgacc       420
     cacatgatcg aggagaccgg ccgtcacgcg ggccaggcgg acatcctccg cgaactgatc       480
     gacggctcga ccggccgctg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page