(data stored in ACNUC7421 zone)

EMBL: CP002047.PE554

CP002047.PE554       Location/Qualifiers
FT   CDS_pept        651169..653301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00554"
FT                   /product="ATP utilising protein"
FT                   /note="COG0145 N-methylhydantoinase A/acetone carboxylase,
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03675"
FT                   /db_xref="GOA:D7C0I4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I4"
FT                   /protein_id="ADI03675.1"
FT                   /translation="MPPDRRVRVGIDVGGTFTDAVAVDAATLELVGQVKVPTSHHHEDG
FT                   VAHGIVQALDHLLEQAGRTPAEVTFLAHGTTQATNALLEGDVAKVGLIGIGTGAGAVFT
FT                   RRLAAFGKLELAPGKLLPLVYAHVADPFDGDAVRAAVTRVQEEGAEVLVASEPFGVDRP
FT                   EGEQAVLDAARPTGLPVAAAHEITSLYGLHKRTRTAVVNAAILPRMLATADLVDSAITK
FT                   AGVTAPLMVMRCDGGVMSLDEMRRRPLLTVLSGPAAGVAGALMQERISEGVFLETGGTS
FT                   TDISVVRRGKVAVRHATILGKASYLNALDVRTVGVGGGSMVRVSGGKVTGVGPRSAHIA
FT                   GLRYACFASLDELRDAKVATVRPMDGDPDDYLVLDAAGGRFAVTMTCAANALGRVPEGD
FT                   FARCDPEVARAALAPPAAMLGMDVAGAARAVLDAGTASVRTVVDAMIRDYRLDRETAVL
FT                   VGGGGGAAAVTPHLAQAAGLEGRIARHNEVISPIGVALALVREQVERIIPGATQEQILA
FT                   VRAEAERAVVAQGAAADGVEVEVTVDPQTSTVRAVATGATELRTQDRAHRADDAERLRV
FT                   AAASLKAQELRVKILAGTDAYTVYGTEVRRRLRAARRPVRVVDADGVVRLGVSDAQVTT
FT                   TTVGAAGETLASLVRDATSYGDGGVRAPAVRLLVGGRIADLSGVLEPGALLALARSELR
FT                   ARAADEPVIAVVESRV"
     atgccccctg accgtcgcgt ccgcgtcgga atcgacgtgg gcggcacgtt cacggacgcc        60
     gtggccgtgg atgccgcaac actcgaactg gtgggccagg tgaaagtgcc caccagccac       120
     caccatgagg acggtgtcgc gcacggcatc gtccaggcgc tcgaccatct cctcgaacag       180
     gccgggcgca ccccggccga ggtcacgttc ctggcgcatg gcacaaccca ggccacgaac       240
     gcgctcctgg aaggcgatgt ggcgaaggtc gggctcatcg ggatcggcac gggtgcgggt       300
     gccgtgttca cccggcgcct cgccgcgttc gggaagctcg aactcgcccc gggcaagctg       360
     cttccgctgg tgtacgcgca tgtggcggac ccgttcgacg gcgatgcggt gcgggccgcc       420
     gtgacccgcg tacaggagga gggcgctgaa gtcctggtcg ccagcgagcc gttcggggtc       480
     gaccggcccg agggtgagca ggcggtgctc gacgcggcgc ggcccacggg gctgccggtc       540
     gcggcggcac acgagatcac ctcgctgtac gggctgcaca agcggacccg taccgccgtg       600
     gtgaacgcgg cgatcctgcc gcgcatgctg gccacggccg atctcgtcga ctccgccatc       660
     acgaaggccg gggtcacggc gccactgatg gtgatgcggt gcgacggcgg ggtcatgtcg       720
     ctggacgaga tgcggcgccg cccgctgctg acggtcctgt cggggccggc ggcgggtgtg       780
     gcgggcgcgc tgatgcagga gcggatcagc gagggagtgt tcctggagac gggtggcacg       840
     tcgacggaca tcagcgtggt gcgacgcggc aaggtggcgg tgcggcacgc gacgatcctc       900
     ggcaaggcgt cgtatctcaa cgccctggat gtgcgcaccg tcggcgtcgg tggcgggtcc       960
     atggtgcgtg tctccggcgg gaaggtcacg ggcgtcggtc cacgcagcgc gcatatcgcc      1020
     gggcttcgct acgcgtgttt cgcctcgctc gacgagctgc gggacgcgaa ggtcgccacg      1080
     gtgcggccga tggacggcga ccccgacgac tatctggtcc tggacgcggc gggtggccgg      1140
     ttcgccgtga cgatgacgtg cgccgcgaac gcgctcggcc gggtccccga gggcgacttc      1200
     gcgcgctgcg acccggaggt ggcgcgggcg gcgctcgccc cgccggccgc catgctcggc      1260
     atggacgtgg ccggtgcggc ccgggccgtg ctggacgcgg ggaccgcatc ggtgaggacc      1320
     gtcgtggacg cgatgatccg cgactaccgg ctcgaccggg agaccgccgt cctggtgggc      1380
     gggggcggcg gagcggcggc ggtgaccccg cacctggccc aggccgccgg tctggaagga      1440
     cgcatcgccc ggcacaacga ggtcatcagc ccgatcgggg tggccctcgc gctggtccgc      1500
     gagcaggtcg agcggatcat ccccggcgcc acccaggagc agatcctcgc cgtgcgtgcc      1560
     gaggccgagc gcgcggtcgt cgcgcagggc gccgcggccg acggcgtcga ggtcgaggtg      1620
     acggtcgacc cgcagaccag caccgtacgg gccgtcgcca ccggcgcgac cgaactgcgc      1680
     acacaggacc gagcgcaccg cgccgatgac gccgagcggc tgcgcgtggc cgctgccagc      1740
     ctcaaggcgc aggagctgcg ggtgaagatc ctggccggca cggacgcgta cacggtgtac      1800
     ggcacggagg tgcggcgccg gctgcgcgca gcgcggcggc cggtgcgggt cgtggacgcg      1860
     gacggggtgg tgcggctcgg ggtgtccgat gcgcaggtga cgacgacgac cgtgggcgcg      1920
     gccggcgaga cgctcgcctc gctggtgcgg gacgccacct cgtatggcga cggcggggtt      1980
     cgggcgcccg cggtgcgcct gctggtgggc ggccggatcg cggatctgtc cggggtgctg      2040
     gaacccgggg ccctgctcgc gctggcccgc agcgagttgc gtgcgcgcgc ggccgacgag      2100
     ccggtgatcg cggtcgtgga gtcccgcgta tga                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page