(data stored in ACNUC7421 zone)

EMBL: CP002047.PE555

CP002047.PE555       Location/Qualifiers
FT   CDS_pept        653298..653888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03676"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I5"
FT                   /protein_id="ADI03676.1"
FT                   /translation="MSGDHGLSLGHDPDLDHDHDLDLAVRLLAGTPTHEGRDPLLLRRW
FT                   AEAAEEFGRRMTPDPAPVRVVERDGGLAAGLLARYRSRPPVVEVYVDTVDRAERLITQR
FT                   GWRHWFPEGSVLAAALAHEQAHAWLHHAHVRAEFKRALGHTALRLGRRRLYAHVAGADE
FT                   LAAHAYARAACGLGRSPLLLTEALAAACSESEK"
     atgagtggcg accacggcct cagcctcggc cacgacccgg acctcgacca cgaccacgac        60
     ctggacctcg ccgtgcggct gctcgcgggg acgcccacgc acgagggccg cgatcccctg       120
     ctcctgcgcc gatgggccga ggcggccgag gagttcggac gccgtatgac ccccgatccg       180
     gcgccggtcc gagtggtcga gcgggacggc gggctcgccg ccggactgct ggcccggtac       240
     cggtcgcggc cgccggtggt cgaggtgtac gtcgacacgg tcgaccgtgc cgaacggctc       300
     atcacccagc gcggctggcg gcactggttc cctgaggggt cggtgctggc cgcggccctc       360
     gcccacgagc aggcacacgc ctggctccat cacgcccacg tccgggccga gttcaagcgg       420
     gcgctcggcc acaccgcgct gcggctcggg cggcgccgcc tgtacgcgca cgtcgcgggc       480
     gccgacgaac tcgccgcgca cgcctacgcc cgcgccgcct gcggtctggg ccgcagcccc       540
     ctgctgctca ctgaggcgct ggccgccgcg tgttccgaaa gcgagaagtg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page