(data stored in ACNUC7421 zone)

EMBL: CP002047.PE556

CP002047.PE556       Location/Qualifiers
FT   CDS_pept        653892..655178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00556"
FT                   /product="transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03677"
FT                   /db_xref="GOA:D7C0I6"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I6"
FT                   /protein_id="ADI03677.1"
FT                   /translation="MGVVILLLMAAGVAAMLTRRLPTAFALVLLAVAIAFAAGAPLTGK
FT                   NSVLDTVLQEGAPALAATMIAILLGSWLGKLLEETGIAATLVRKIVEFGGDRPVFVALG
FT                   VLAVSALVGTVTGSAPAAMLAGLIGIPAMIAVGIPKVTAAGTILMGIAVGIPFELPVWQ
FT                   FFSTALELPVDTVRGFMLKLFPFALVAAVAYVLVESRRRGVEHTWSLTSVRGESKPRSR
FT                   RQLLGDAPWYALLTPVVPLVLALGFELAIIPSLLAGVLYALVTTTPPREMNRRLLRTLY
FT                   GGFEVAAAPITLFVAIGILLAAVKLPGAVDALEPLVKAVSPQNAVLFVLVFTLLVPLCL
FT                   YRGPLNVFGLGAGIAGVLIATGIYPATAVLGMATSYNQVFGVADPTSTQTVWSAQYAGV
FT                   SPQQVMVRTLPYVWAVALGGLCVTAATQL"
     atgggtgtcg tgattctgct cctcatggcg gcgggtgtcg ccgccatgct cacccgcagg        60
     ctgcccaccg cgttcgcgtt ggtgctgctc gccgtggcga tcgcgttcgc cgcgggcgcg       120
     ccgctgaccg gaaagaacag cgtgctcgac acggtgctcc aggagggcgc gcccgcgctg       180
     gcggccacga tgatcgcgat cctgctcggt tcgtggctcg gcaagctcct ggaggagacc       240
     ggcatcgcgg ccactctggt ccgtaagatc gtcgaattcg gcggcgaccg gccggtgttc       300
     gtggcgctcg gcgtcctcgc ggtgtcggcc ctcgtgggca cggtgacggg gtccgcgccc       360
     gcggcgatgc tcgccgggct catcgggatc ccggccatga tcgcggtggg catcccgaag       420
     gtgacggccg ccggcacgat cctcatgggc atcgcggtgg gtatcccctt cgaactgccg       480
     gtgtggcagt tcttctccac ggcgttggaa ctccccgtgg acaccgtgcg cggcttcatg       540
     ctgaagctgt tcccgttcgc gctggtggcg gcggtcgcgt acgtcctggt ggagtcgcgg       600
     cggcggggcg tggagcacac gtggtcgctc acatcggtgc ggggagagtc gaagccacgc       660
     agccgccggc agctgctcgg ggacgctccg tggtacgcgc tcctcacacc ggtggtgccg       720
     ctcgtcctgg ccctcggctt cgaactggcc atcatcccct cactattggc gggggtgttg       780
     tacgcgctgg tgacgaccac gccaccacgc gagatgaacc gccgcctgct gcgcacgctg       840
     tacggcggct tcgaggtggc ggcggctccg atcacactgt tcgtggccat cggcatcctg       900
     ctcgccgcag tgaagctgcc cggcgccgtc gacgcgctgg agccgctggt caaggccgtc       960
     agcccgcaga acgcggtgct gttcgtgctg gtcttcacgc tcctggtgcc gctgtgtctg      1020
     taccgcggcc cgctgaatgt cttcggcctc ggcgccggca tcgcgggcgt cctcatcgcc      1080
     accggtatct acccggccac cgccgtcctc ggcatggcca cctcgtacaa ccaggtcttc      1140
     ggcgtcgccg acccgaccag cacccagacg gtgtggagcg cccagtacgc gggcgtctca      1200
     ccgcaacagg tgatggtgcg gacactgccg tacgtatggg ccgtggcgct cggcggcctg      1260
     tgcgtcaccg ccgcgaccca gctgtga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page