(data stored in ACNUC7421 zone)

EMBL: CP002047.PE557

CP002047.PE557       Location/Qualifiers
FT   CDS_pept        655252..656223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00557"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03678"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I7"
FT                   /protein_id="ADI03678.1"
FT                   /translation="MFLRATAATGAALTLGGLSTQSASAAPGGFPDYTYVRTLLTPSQL
FT                   KYNPTGEIIFPTVRGVYDKLASPLGRYYLYYAPHDAPGGICLAYGNSLEGPFTEYPANP
FT                   IVSNKWDSHYSVSHVSSPHVLWKEDVKEFWLYFHGENTTTRLARSKDGIHFTYDKVVLN
FT                   TSMMPAGTTETSYARVFRHDLPSRGARYVMLFMTNNTTNHRDICWGWSADARTWTFAQT
FT                   PLVRHSDVGAINVGGPHLLTRNGSAYVVYNKDKTSGGDIMITEVGKDFSLRKHLGVFYD
FT                   SRSSAPENGRAAAPSFGTDGGVPYMIYEAGERLKGAIAVARG"
     atgttcctcc gtgcgaccgc cgccactggc gccgcgctca ccctcggcgg cctgtcgacg        60
     cagtccgcgt cggccgcgcc cggaggcttc cccgactaca cctacgtacg gacgctgctg       120
     acaccgtcgc agctgaagta caaccccacg ggcgagatca tcttcccgac cgtgcgcggc       180
     gtctacgaca agttggcgtc accgctcggc cgctactacc tctactacgc gccccacgac       240
     gcgcccggcg gtatctgcct cgcctacggg aactcgctgg agggcccgtt caccgagtac       300
     ccggcgaacc cgatcgtgtc gaacaagtgg gactcgcact actcggtcag ccatgtctcc       360
     tcgcctcatg tgctgtggaa ggaggacgtc aaggagttct ggctgtactt ccacggcgag       420
     aacaccacca cccgcctcgc ccgctcgaag gacgggatcc acttcaccta cgacaaggtg       480
     gtcctgaaca cgtccatgat gcccgccggc accaccgaga cgtcctacgc ccgggtgttc       540
     cggcacgacc tgccgtcccg cggcgcccgc tacgtgatgc tgttcatgac caacaacacc       600
     accaaccacc gtgatatctg ctggggctgg tccgccgacg cccggacctg gaccttcgcc       660
     cagacgccgc tggtgcgcca ctcggacgtc ggcgcgatca acgtcggcgg cccccatctg       720
     ctcacgcgca acggctccgc gtacgtggtc tacaacaagg acaagacgag cggcggcgac       780
     atcatgatca ccgaggtggg caaggacttc tcgctccgta agcacctcgg cgtcttctac       840
     gactcccgct cctcggcacc cgagaacggc cgggccgcgg ccccctcctt cggcacggac       900
     ggcggagtgc cgtacatgat ctacgaggcg ggggaacggc tcaagggcgc gatcgcggtg       960
     gcgcggggat ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page