(data stored in ACNUC7421 zone)

EMBL: CP002047.PE559

CP002047.PE559       Location/Qualifiers
FT   CDS_pept        657183..657575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00559"
FT                   /product="AraC family transcriptional regulator"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03680"
FT                   /db_xref="GOA:D7C0I9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0I9"
FT                   /protein_id="ADI03680.1"
FT                   /translation="MADEDLLTDPVLPVRWVRLVTARPVPAQALGYPGVALTPDQAVLH
FT                   TLFRRQEETVAASIRRRRLERCHADLTDPRLRRRSISAIAARWGFVRPADFSRAFRAAY
FT                   GVAPRELRQAALRNPPDTRQAAPGDK"
     ttggccgatg aggatctgct gacggatccg gtgctgccgg tgcgatgggt ccgattggtg        60
     accgcccggc ccgtcccggc gcaggcgctc ggttacccgg gggtggccct gacgcccgat       120
     caggcggtgc tgcacactct cttccgccgg caggaagaga ccgtggcagc ctcgatacgc       180
     cggcgccgcc tggaacgctg ccacgccgac ctcaccgacc cccggctgcg gcggcggtcg       240
     atcagcgcca tcgccgcccg gtggggattc gtacgcccgg cggacttcag ccgcgcgttc       300
     cgcgccgcgt acggcgtggc gcccagagaa ctccggcagg cggcactgcg caatccgccg       360
     gatacgcggc aggccgcgcc gggcgacaag taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page