(data stored in ACNUC7421 zone)

EMBL: CP002047.PE56

CP002047.PE56        Location/Qualifiers
FT   CDS_pept        52326..53927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00056"
FT                   /product="Rab family protein"
FT                   /note="COG4886 Leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03177"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI6"
FT                   /protein_id="ADI03177.1"
FT                   /translation="MHEDIWGDPTRYRYAAAPRTGLSLPLDDSLERAIQEAAEASGSED
FT                   QVEFLMVEGQRLTDLRPLARLRGLRELVVHSPVLKDLGPLALLPTLRRLSVTAPVSDLG
FT                   PLSALTSLTHLDLEQTMVTDLAPLASLAKLRDLSVTQGPLADLGPLRRLGLMRLYVYRT
FT                   QVTDLTPLADAPLLWVLGINDCPVTDVSVLTQLPSLTHVLMRRTRVKDLGDLPTRAPHI
FT                   TFEGYDEKSPEPTVTPDTPGDPIDPIDPAELLARYRAAEDKERYRLGLRLLGSRDAVAI
FT                   EALIRELLSDSDRFTMRGLLLDGGHGSIPFPANPWGIPADADLDAAIGHIWAPLADHLP
FT                   TFLDILRHETLALGLLTDQDGQPSLAYVFVGWNPLPGRVRLDDLSHWREDEGALRIVHG
FT                   GAPRTDIDPYLVVPVLGGPVPTPLRELWAVHRFLGDGFQAQYDDRLTTNLGAFCSRNLP
FT                   GFAERNNGAQPDRFVLFASQDYYNAVLDLDILDQAGNPTITTWIDWEIGARQQFWDWFD
FT                   AELPDTALLGLRREAR"
     atgcacgaag acatctgggg tgaccccaca cgctaccgct acgccgccgc tccgcggacg        60
     gggttgagcc tgccgctcga cgactcgctg gaacgagcga tccaggaagc agcggaggcc       120
     tcaggcagcg aggaccaggt cgaattcctg atggtggagg gtcaacgcct cactgatctg       180
     aggcccctgg cgcggttgcg cgggctgcgg gagcttgtcg tccattcgcc tgtcctgaag       240
     gatctcggcc cgctggccct tcttcccacg ctgcggcggc tgtccgtcac cgcacccgtc       300
     tcggatctgg gcccgctgtc cgcactcacc tccctcaccc acctcgacct ggaacaaacc       360
     atggtgacgg acctcgcgcc gctggcttcg ttggccaagc tgcgtgacct gtccgtgacg       420
     cagggccccc tcgccgatct cggcccgctc cgcaggctcg gactcatgcg tctgtacgtc       480
     taccgcaccc aggtcaccga cctgacgccg ctggccgacg cgcccctgct gtgggtgctc       540
     ggcatcaacg actgcccggt caccgacgtc tccgtactca cccaactgcc cagcctcacc       600
     catgtgctga tgcgccgcac ccgcgtcaag gacctcggcg acctgccgac ccgcgccccg       660
     cacatcacct tcgaggggta cgacgagaag tcacccgagc cgaccgtcac gcccgacacc       720
     cccggcgacc ccatcgaccc catcgacccc gccgaactgc tggcccgcta ccgcgccgcc       780
     gaggacaagg agcgttacag gcttggccta cggctgctcg gcagccggga cgccgtagcc       840
     atcgaggcgc tgatccgaga gctactgtcg gacagcgaca ggttcacaat gcgcggactg       900
     ttgctcgacg gcggacacgg gagcattccc ttccccgcca acccctgggg tatcccggcc       960
     gatgccgacc tcgacgcggc gatcgggcac atatgggccc cgctcgccga ccatctgcca      1020
     accttcctcg acatcctgcg ccacgagaca ctggctctcg gactgctcac cgaccaagac      1080
     ggccagccgt cgctcgccta cgtgttcgtg ggctggaacc cgctcccggg ccgggtacgc      1140
     cttgacgacc tgtcccactg gcgggaagac gagggcgcgc tgcgcatcgt gcacggcgga      1200
     gccccgcgca cggacatcga tccatacctg gtggtgccgg tcctcggcgg tcccgtgccg      1260
     acgccgctgc gcgagctgtg ggccgtccac cgttttctcg gcgacggctt ccaggcgcag      1320
     tacgacgacc gactgaccac aaatctgggc gcgttctgct cgcgcaacct ccccgggttc      1380
     gccgaacgca acaatggcgc ccagccggat cgattcgtgc tgttcgcaag ccaggactac      1440
     tacaacgccg tgctggatct cgacatcctc gaccaagccg gcaacccgac cattaccacc      1500
     tggatcgact gggagatcgg cgcccggcag cagttctggg actggttcga cgccgagctg      1560
     cccgacacgg ccctactcgg ccttcgacgg gaagcacggt aa                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page