(data stored in ACNUC7421 zone)

EMBL: CP002047.PE562

CP002047.PE562       Location/Qualifiers
FT   CDS_pept        complement(658665..659969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00562"
FT                   /product="hydrolytic protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03683"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J2"
FT                   /protein_id="ADI03683.1"
FT                   /translation="MRRAVTLPGTAGTPDPSALAPLGAERTERTETGAAGATGAAVEAD
FT                   TAEQPKASLNEPASAGESVESVTPGAESVESATPGAAGAATASAGATAASEAGAPDTPA
FT                   APDVPPAEADGHADGHGSADGMASAEGDYPPGADTGADEDEPPSGRPTKALLAAAAIAG
FT                   ALLITVPFLAFGADDDDHKTEAAPEPTSGMTVPKIEEKGPGTYTAQSPAPSPTKESKSP
FT                   SPAAKPRPEPSSEQPKSRPEPEPEPSSEQPKPRAKKVVPASKPYLLAPEQRTNFQLKNV
FT                   TTGRCADLPGMGKGKLDGAVLQHDCFADWNADNQVWDFVLAQKGKGPNGRNLVVIKNKK
FT                   SGLCLDLPQRGSQPSRTALNQTHCNLTLQDNQLWWVENRGGNRTFWIHNYASDQRCLEV
FT                   WGEKPDFGGNDARLGIYKCSPTDDHEWRLMSKGES"
     gtgcgccgcg ccgtcaccct gccgggcacc gccggtacgc cggatccctc cgcgttggcg        60
     ccgctgggcg cggagcgtac ggagcgtacg gagaccggcg cggccggtgc cacaggcgcc       120
     gcggtcgaag cggacaccgc cgagcagccg aaggcctcgc tgaacgagcc cgcgtcggct       180
     ggtgagtccg ttgagtccgt gacgccgggt gctgagtccg ttgagtccgc gacgccgggc       240
     gcggccgggg ccgccacggc gtccgccggg gcaaccgcgg cgtccgaggc cggggcgccg       300
     gacactccgg cggccccgga cgtaccgccc gccgaggccg acggccacgc ggacggccac       360
     ggatccgccg acggcatggc gtcggccgag ggcgattacc cccctggcgc cgacaccggg       420
     gccgacgagg acgagccccc ctcgggccgt cccaccaagg cgctgcttgc cgccgccgcc       480
     atcgcgggcg cgctgctgat aaccgtgccg ttcctggcct tcggggccga tgacgacgat       540
     cacaagaccg aggcggcgcc cgagcccacc tcgggcatga cggtcccgaa gatcgaggag       600
     aagggccccg gtacgtacac cgcccagtca cccgccccgt cccccaccaa ggagagcaag       660
     tccccttcgc cggcggccaa gccccggccc gagccgagca gcgagcagcc gaagtcccgg       720
     cctgagcctg agcccgagcc gagcagcgag cagccgaagc cccgggcaaa gaaggtggtg       780
     ccggccagca agccctattt gctcgccccg gagcagcgta cgaacttcca gctcaagaac       840
     gtcacgaccg gccggtgtgc ggacctgccc ggcatgggca agggcaaact cgacggcgcg       900
     gtcctgcagc acgactgctt tgccgactgg aacgcggaca accaggtctg ggacttcgtc       960
     ctggcacaga agggcaaggg acccaacggc cgcaatctcg tcgtgatcaa gaacaagaag      1020
     agcggcctgt gcctggacct gccccaacgc ggcagccagc cgagcaggac cgcgctcaac      1080
     cagacccact gcaacctcac gctccaggac aaccagctgt ggtgggtcga gaaccggggc      1140
     ggcaaccgga cgttctggat ccacaactac gccagcgatc agcggtgcct ggaggtctgg      1200
     ggcgagaagc ccgacttcgg cggcaacgac gcacgtctgg gcatctataa gtgctctccc      1260
     actgacgacc acgagtggcg gctgatgtcc aagggcgagt catga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page