(data stored in ACNUC7421 zone)

EMBL: CP002047.PE563

CP002047.PE563       Location/Qualifiers
FT   CDS_pept        complement(660033..663233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03684"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J3"
FT                   /protein_id="ADI03684.1"
FT                   /translation="MSRSGGARARWFSRRGARARTGPAADPAPSAPVTTLDRSERPGGG
FT                   GRGRGGALLVEEYGGVMLLRSPADDTLSTSDVADLARALSVDPEHTVTVVAGADASSAG
FT                   ELWPRLGRVLDSLRSDGVGVVRLVLAAAGDDRPDEPAVARRIADAWEIEVIAPDGVAVV
FT                   VPGGSLFVPERRSGRGVARGGGERGGWWRFAPGVEPVRIGSRQPAPAWQPAVEYLPVGT
FT                   SGGYAVEQIPAGVLVRSRDAIPPRPDDLCYAVPADPRGPTVLLGAPHDEDIPAGDLTEL
FT                   LTALPEAVRPRVRLAPGGPRDILRTSQSVADSLGVELLVRTGMPLMSYGIPTEPGTVRS
FT                   VLVGADGAPRWQPFVDTVVCAPAREGETAPSPRLSRWSPPVPGRGSAEHGAIRLSEQWR
FT                   VTVTRAGLWITDTESEPPPATARAVDPEGPAIELGHPGRPIDATLYPVLGKLLGGLGAD
FT                   VCGRARLFVLGTCADGGRELRRIAAEHGLRTLRFGAGLAPARPEVRRPAPAESAEAPTE
FT                   PGPAPVASAPAAEAEPEPDHERDPMSLGTLPEATPQEARLPEATPLETTEDPRPVFPPT
FT                   RPSMVSTASAPVAAPAAHDTSAAPGEPAVSATSGAGAGPGPESSRPRTGGPGPSRPPGS
FT                   GRVRDPERPEPPGADRPLRTGSGTPPPPMEPDQRSQSLPPMGLDAMLDLLRSQSPPDGA
FT                   GDGDSAPSVSPLTRRPTQQGAPLSRPSQGQAPQATPNTPATPATRTPPASPESSEPPAL
FT                   AEPPAAPVSPAAPLSTTGSQSTQAPPPTTAPEPTTPVTPATPEPPAPEPPAAPLRPLPP
FT                   VPFLPGHVSTEAERTAFRALADAVWERHSAAVTRALTRMPALRGPEQEAARIDLIALHM
FT                   YLDTSYDLDTPDAPDTPAAGLSQDALARGMRTGDERLLPYAACVASALRRLPSYRGLAC
FT                   RRTHEADGGLVPGTLLRDPAPVCALPPGAGAPRPAGAQYAIWSVTGRRTRQLTGRPGSA
FT                   SGGDEVVFAPGTLLRVLDVRDTAGAPLVLLREVPTTASSPSAAGAVPQDTRLDDHDRAA
FT                   LDRLDEALRRHRPAATHG"
     gtgagccgtt ccgggggcgc cagagcccgc tggttcagca ggcggggcgc ccgagcccgt        60
     accgggcccg ccgccgaccc cgcgccgtcc gcgcccgtca ccacgctgga cagatcggag       120
     cgccccgggg gcggcggccg cgggcggggc ggggcgctgc tcgtcgagga gtacggcggc       180
     gtcatgctgc tccgctcccc cgcggacgac acgctgtcca cctccgatgt cgccgacctg       240
     gcccgggccc tgtccgtcga cccggagcac accgtgacgg tggtcgccgg ggccgacgcg       300
     tcgtcggccg gtgagctgtg gccgcggctc ggcagggtgc tcgactcgct ccgctcggac       360
     ggggtcggag tggtccggct cgtcctggcg gcagcgggcg acgaccggcc ggacgagccc       420
     gccgtggccc gccggatcgc cgacgcctgg gagatcgagg tgatcgcccc cgacggcgtc       480
     gccgtcgtgg tgcccggcgg cagtctgttc gtaccggagc ggcgctcggg ccggggcgtc       540
     gcgcgcggcg gtggcgagcg cggcggatgg tggcgcttcg cgccgggggt ggaaccggtg       600
     cggatcggct cgcgccagcc ggcccccgcg tggcagcccg cggtcgagta cctgccggtc       660
     ggcacctccg gcggatacgc cgtcgagcag atcccggcgg gcgtgctggt ccggtcccgg       720
     gacgcgatcc cgccccgccc cgacgacctc tgctacgccg taccggccga cccgcgcggc       780
     cccaccgtgc tgctgggcgc gccacacgac gaggacattc cggcgggcga cctcaccgaa       840
     ctcctcaccg ccctccccga ggccgtcagg ccccgcgtcc ggctcgcccc cggcggcccc       900
     cgggacatcc tgcgcaccag ccagtcggtc gccgactcgc tcggcgtcga actcctcgtc       960
     cggaccggca tgccgctgat gtcctacggc attccgaccg agcccggcac ggtgcggtcc      1020
     gtgctcgtcg gcgccgatgg cgcgcctcgc tggcagccgt tcgtggacac cgtggtgtgc      1080
     gccccggcac gcgagggcga gaccgccccg agcccccgcc tgtcgcgctg gagcccgccc      1140
     gttccgggcc gcggcagcgc ggaacacggc gccatacgcc tctccgagca gtggcgggtc      1200
     acggtcaccc gggcgggcct gtggatcacc gacaccgaga gcgagccgcc accggccacc      1260
     gcccgcgcgg tggaccccga agggccggcg atcgaactgg gccatcccgg gcggccgatc      1320
     gacgcgacgc tgtaccccgt gctcggcaaa ctgctcggcg gactcggcgc ggacgtgtgc      1380
     ggccgggcca ggctgttcgt gctcggtaca tgcgcggacg gcggccgcga actgcgccgc      1440
     atagccgcgg aacacggcct gcggacgctc cgcttcgggg ccggcctcgc gcccgccagg      1500
     cccgaggtgc ggcgcccggc cccggccgag tccgccgagg cgccgacgga gcccggcccg      1560
     gcgccggtcg cgtccgcccc ggccgcggag gcggagcctg agccggacca cgagcgcgat      1620
     ccgatgtccc tgggaacgct ccccgaagcc acgccgcagg aagccaggct gccggaagcc      1680
     acgccgctgg aaaccaccga ggatccgcgt cccgtgttcc caccgacgcg accgtcgatg      1740
     gtcagcacgg cgtcggcccc ggtcgcggcc ccggccgcgc acgacacctc cgccgcgccc      1800
     ggcgagcctg ccgtgtccgc cacatccggg gcaggggcag ggcccgggcc ggagtcctcc      1860
     aggccgcgaa cgggcggccc gggcccgagc aggccgccgg gctccggccg cgtacgggac      1920
     cccgagcggc ccgaaccgcc aggagcggac cgccccttgc ggacggggag cggcacgccc      1980
     ccacccccga tggagccgga ccagcggagc cagtcgctgc ccccgatggg actggacgcg      2040
     atgctggacc tgctccggtc gcagagcccg cccgacggtg ccggagacgg ggacagcgcc      2100
     ccgtcggtat cccccctgac ccgtcggccc acccaacagg gtgccccgct gtcgcgccca      2160
     tcccagggcc aggcccccca ggcgacgccg aacacccccg cgaccccggc cacgcggacc      2220
     ccgccggcga gcccggagtc ctcggagcca ccggcgcttg ccgagccacc ggcggccccc      2280
     gtatccccgg cggccccact gtccaccacg gggtcgcagt ccacgcaggc gcccccgccg      2340
     accacggcgc ccgagcccac gactcctgtg acccccgcga ctcccgagcc cccggccccc      2400
     gagcccccgg ccgcgcccct ccggccgttg ccgccggttc cgttcctgcc ggggcatgtc      2460
     agtacggagg ccgagcggac cgccttccgg gcgctcgcgg acgcggtgtg ggagcggcac      2520
     agcgccgcgg tcacccgcgc cctcacccgg atgcccgcgc tgcgcgggcc ggaacaggag      2580
     gcggcgcgca tcgacctgat cgcgcttcac atgtacctgg acacctcgta cgacctcgac      2640
     accccggatg ctccggacac cccggcggcg gggctgagcc aagacgcgct cgcccgcggc      2700
     atgcgtacgg gcgacgagcg gctgctgccg tacgccgcct gtgtggcctc cgcgctgcgg      2760
     cgcctgccgt cgtaccgggg cctggcgtgc cgccgtaccc acgaggcgga cggcgggctg      2820
     gtccccggaa ccctgctgcg cgatccggcg ccggtgtgtg cgctgccgcc gggggccggg      2880
     gcgccgcgcc ctgccggcgc gcagtacgcc atctggtcgg tcaccgggcg ccgcacgcgc      2940
     cagctgaccg gccgccccgg ctccgcatcc ggcggggacg aggtcgtctt cgcccccggg      3000
     acgctgctgc gggtgctcga tgtccgcgac accgccggcg ccccgctggt gctgctgcga      3060
     gaagtaccca ccaccgcgtc ctccccgtcc gccgccgggg cggtaccgca ggacacgcgg      3120
     ctcgatgacc acgaccgtgc cgcactcgac cggctggacg aggcgctgcg ccgccaccgg      3180
     ccggctgcca cgcatggata a                                                3201
//

If you have problems or comments...

PBIL Back to PBIL home page