(data stored in ACNUC7421 zone)

EMBL: CP002047.PE564

CP002047.PE564       Location/Qualifiers
FT   CDS_pept        complement(663230..663964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03685"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J4"
FT                   /protein_id="ADI03685.1"
FT                   /translation="MSESNGEATTPATSGEAPATSGETPATVDPAPPEEFVQAAKAAPN
FT                   HWLYLTDPTWRGEAPPPEFAVVGQWRSDDNGEIVEWQANEDYVPSPGARGWPEPTDDVD
FT                   RAVQLATTGYGPADDVTAALAKAELAMLVTADGRPVSASAADGTAVVPIYTSARHLHKT
FT                   GPLGFERVRIADVLDRIPEGHNVCVNSSAAVSMVLITDKLVQALAAVESAPAEEADGSE
FT                   RAEADQAEAGQADAREERGGQA"
     atgagtgagt ccaacggcga agccactacc ccagccacca gcggcgaagc cccagccacc        60
     agcggtgaaa cccctgccac ggttgacccc gcaccgcccg aggagttcgt ccaggcggcc       120
     aaggcggcgc cgaaccactg gctctacctg accgacccca cctggcgcgg ggaggccccg       180
     ccgcccgagt tcgcggtggt cggccagtgg cgctccgacg acaacggcga gatcgtcgag       240
     tggcaggcca acgaggacta cgtgccatcg ccgggggcgc gggggtggcc cgagcccacc       300
     gacgacgtgg accgtgccgt ccagctcgcc accaccggct acggcccggc ggacgacgtc       360
     accgccgccc tggccaaggc cgaactggcg atgctggtca cggcggacgg ccggccggtg       420
     agcgcgtcgg cagccgatgg cacggcagtg gtcccgatct acacctcggc gcgccacctc       480
     cacaagaccg gcccgctggg gttcgagcgg gtgcggatcg ccgacgtcct cgaccggatc       540
     cccgagggcc acaacgtgtg cgtcaacagc tccgccgcgg tgagcatggt gctgatcacg       600
     gacaagctgg tgcaggcgct ggcggccgtg gagagcgccc cggcggagga ggcggacggg       660
     agcgaacggg ccgaagcgga tcaggccgag gcgggccagg ccgatgcccg ggaagaacga       720
     ggaggacagg cgtga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page