(data stored in ACNUC7421 zone)

EMBL: CP002047.PE567

CP002047.PE567       Location/Qualifiers
FT   CDS_pept        complement(722830..723243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03688"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J7"
FT                   /protein_id="ADI03688.1"
FT                   /translation="MSDDTYDMNLGKMRGALNGLAGLGDRARVLEGQYLADHERYKLWN
FT                   GDSSHPDDYYEKTQPDDEKTTQTLIGTIKSLGLAITAAHSALLESLDSVKAVHADVTEL
FT                   IEQQERIADDDSGYESDDSGYGSGDDESGGGKH"
     atgagcgacg acacctacga catgaacctg ggcaagatgc ggggagcgct caacggcctg        60
     gccggtctgg gggaccgagc cagggtcctg gaggggcagt acctggccga ccatgagagg       120
     tacaagctct ggaacggcga ctccagccat ccggacgact actacgagaa gacccagccc       180
     gacgacgaga agacaacgca gacgctcatc ggaacgatca agtcgctcgg gttggcgata       240
     acggcggcgc actccgcgct gctggagagt ctcgacagcg tcaaggccgt tcatgccgac       300
     gtgaccgagc tgatcgagca gcaggaacgc atcgccgacg acgacagcgg ctacgagtcc       360
     gacgacagcg gctacgggtc cggcgacgac gagtccggcg gcggaaagca ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page