(data stored in ACNUC7421 zone)

EMBL: CP002047.PE568

CP002047.PE568       Location/Qualifiers
FT   CDS_pept        complement(723240..723713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00568"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03689"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J8"
FT                   /protein_id="ADI03689.1"
FT                   /translation="MSELNDPYAERIHQARAHLEATRAAIARAEQDLADHNVTARSRDR
FT                   AVEVTIGPQGELSGLTFLDNKYLSMTGPQLAASVLEAAQRGRQQVAQRVMDTFRPLMAA
FT                   NPDVPGSRDIDVDWDRLFGSAFEGGRRAGGGRSSSDRLRDEIHEDPDVPGGRP"
     ttgagcgagt tgaacgatcc gtacgcggaa cgcatccatc aggccagggc ccacctcgaa        60
     gccacgaggg ccgccatcgc ccgcgccgag caggacctcg cggaccacaa cgtgacggcc       120
     cgttcgcggg accgtgcggt cgaggtcacc atcggcccgc agggagagct gagcgggctg       180
     acgttcctgg acaacaagta cctgagcatg accggaccgc aactggccgc ctcggtgctg       240
     gaggcggccc agcgggggcg tcagcaggtc gcccagcggg tgatggacac cttccgcccg       300
     ctgatggcgg cgaatcccga tgtcccgggg tcccgggaca tcgacgtcga ctgggaccgg       360
     ctcttcgggt cggcgttcga gggaggccgc cgggcgggtg gcggcaggtc gtccagcgac       420
     cggttgcgcg acgagatcca cgaggacccg gatgttcccg gagggcggcc atga             474
//

If you have problems or comments...

PBIL Back to PBIL home page