(data stored in ACNUC7421 zone)

EMBL: CP002047.PE569

CP002047.PE569       Location/Qualifiers
FT   CDS_pept        complement(723778..724728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03690"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0J9"
FT                   /protein_id="ADI03690.1"
FT                   /translation="MSHDLITGPVNGDDSLHNPGGSESHIDSHGRVVTEYPDGHTTTID
FT                   PDNQTSSITTPDGHTRSGPLNVDNVLNNPDGSRSHIDPQGQVVTEYPDGSKTTIDPDTG
FT                   GTSITDPDGKSVTGHLNGSGNSLPDFQQQSPGSNFGNIGGGGSGNSNSLYDPSSYEEEL
FT                   WDKDPYQSPGDQNGNGNNQAAANAGNQNQSGAPMGGGMPLNPGTMPGRGGGGGGGEGGP
FT                   SERVRNVIDSGDVVSNRRATPRPGRPGGGLLDERENVITSGGTPFMPPMGGAGGAGSPG
FT                   QVATQTDDRERESWVPEDEDVWGSDEGGSPAVIGR"
     atgtcacacg acctgatcac ggggccggtg aacggcgatg actcactgca caaccccggc        60
     gggagcgagt cgcacattga ctctcacggc cgggtggtca cggagtaccc ggacggtcac       120
     accaccacga tcgatccgga caaccagact tccagcatca ccacgccgga cggccacacg       180
     cgttccgggc cgctcaacgt cgataacgtc ctcaacaacc ccgacggcag caggtcgcac       240
     atcgatcctc aggggcaggt cgtcacggag tacccggacg gcagcaagac cacgatcgat       300
     ccggacaccg gcggcacctc gatcaccgac ccggacggca agtcggtcac ggggcacctg       360
     aacggaagcg gcaactcact cccggacttc cagcaacagt cccccggatc caacttcggc       420
     aacatcgggg gcggcggaag cggcaactcc aattcgctgt acgacccgtc ctcgtacgag       480
     gaggagctgt gggacaagga cccgtaccag tcgcccggtg accagaacgg caacggcaac       540
     aaccaggcgg cggccaacgc cggcaaccag aaccagtccg gggcaccgat gggcggcggc       600
     atgcccctca accccggaac aatgcccggc cgcggcgggg gcggcggcgg tggcgagggc       660
     ggcccttccg agcgggtccg caacgtgatc gacagcggcg atgtggtcag caaccgccgg       720
     gcgaccccca ggcccggccg ccccggtggc gggctcctcg acgagcgcga gaacgtgatc       780
     accagtggcg gcaccccgtt catgccgccg atgggcggcg cgggcggggc cgggtcgccc       840
     ggccaggtgg cgacccagac cgacgaccgc gagcgcgagt cgtgggtgcc ggaggacgag       900
     gacgtgtggg gcagcgacga gggtggctcg ccggccgtga tcggccgatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page