(data stored in ACNUC7421 zone)

EMBL: CP002047.PE570

CP002047.PE570       Location/Qualifiers
FT   CDS_pept        724765..725325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03691"
FT                   /db_xref="GOA:D7C0K0"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K0"
FT                   /protein_id="ADI03691.1"
FT                   /translation="MVERLLLLFLVLLLLLLVLVLLVLLLLLLLLVLLVLVLPLPLLVL
FT                   LVPLLLLFLLLLLPLLLLLLVLLLLLLVLLLLLLLLRLLGLGLLLLLSLLFLELLLLLL
FT                   LLFLELLLLGSWLPLTTSPMTMGSQRTLVRLYFQTSLVTSLSTSMSQTSGLPWSSRQSS
FT                   LQVRKRPSAAVRTSARKRRRSLP"
     ttggttgagc gcctgctcct gctgtttctg gtactgctct tgctgctgct ggtactggtc        60
     ctgctggtat tgctgctgtt gttgttgctg ctggtactgc ttgtcctggt actcccgctg       120
     ccgctgctgg tactcctcgt ccctcttctg ctgctcttcc tgttgctgct cctgccgctg       180
     ttgctgctcc tcctggtact gctgttgctc cttctggtac tgctcctgct tcttctcctg       240
     ctccgcctgc ttggcctcgg cctccttctc cttctgtccc tgctctttct ggagctgctc       300
     ctgctccttc tcctgctctt tctggagctg ctcctgcttg gctcatggct accgctgacc       360
     acatcaccca tgacgatggg ctcccagcgg accttggtga ggttgtactt ccagacgtcc       420
     ttggtgacct ccttgagcac ctcgatgagc cagaccagcg gattgccgtg gtcgtcgcgc       480
     cagtcatccc tccaggtccg gaagagacca tcggcggccg tccggacatc ggcgcggaag       540
     cgccgcaggt cgttgccgta g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page