(data stored in ACNUC7421 zone)

EMBL: CP002047.PE573

CP002047.PE573       Location/Qualifiers
FT   CDS_pept        complement(727701..728189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03694"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K3"
FT                   /protein_id="ADI03694.1"
FT                   /translation="MAKSIQLNKEWMEHFINVDVHDFQVELKNILKDRGDIPALGSLKK
FT                   ENPHDFADPPIPSGTQLPLTIGAMTGDGEELTNGAHLHKTLVALIDQIVGMIEEQQTLF
FT                   DDIEENLRETVHTLLKTQDGNLAKIDGEKFLDGLEDVEDDLTSGGSGSGGGDGENDEN"
     atggccaagt cgatccagct gaacaaggag tggatggagc acttcatcaa cgtcgatgtg        60
     cacgacttcc aggtggagct gaaaaacatc ctcaaggata ggggcgatat tcccgcgctg       120
     ggcagcctga agaaggagaa tccgcatgat ttcgcggatc cccccatccc ctcggggacg       180
     cagctgcccc tcactatcgg cgccatgacc ggtgatgggg aggagctgac caacggggcg       240
     cacctgcaca agaccctggt ggctctcatc gaccagatcg tggggatgat cgaggaacag       300
     cagacgctgt tcgacgacat cgaggagaac ctgcgggaaa ccgtccatac gttgctgaag       360
     acacaggatg gcaacctggc caagatcgat ggcgagaagt tcctcgacgg cctcgaagac       420
     gtggaggacg acctgacttc cggagggtcg ggctccggcg ggggcgatgg cgagaacgac       480
     gaaaactga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page