(data stored in ACNUC7421 zone)

EMBL: CP002047.PE574

CP002047.PE574       Location/Qualifiers
FT   CDS_pept        complement(728299..728616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00574"
FT                   /product="hypothetical protein"
FT                   /note="COG4842 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03695"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K4"
FT                   /protein_id="ADI03695.1"
FT                   /translation="MDFSDGHIYVDFKGTDNAAEDMRLQTQNIDKILSQLESELQKFIS
FT                   SWEGEDRDVYVQKQKTWHEAVQEMKRLLASHAGLLNDIGDNYRTNQRNLTASWENVKIG
FT                   R"
     atggacttct ccgacgggca catatacgtc gatttcaagg gcaccgacaa cgcggctgag        60
     gacatgcggc tgcagactca gaacatcgac aagattctca gccagctcga atcggagctg       120
     cagaagttca tcagcagctg ggaaggtgaa gaccgggacg tctacgtcca gaagcagaag       180
     acgtggcacg aggccgtcca ggagatgaag cggctcctcg cgagccatgc gggcctgctc       240
     aacgacatcg gtgacaacta ccggaccaac cagcggaacc tcacggccag ctgggaaaac       300
     gtgaagatcg gccgctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page