(data stored in ACNUC7421 zone)

EMBL: CP002047.PE575

CP002047.PE575       Location/Qualifiers
FT   CDS_pept        complement(728702..729037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03696"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K5"
FT                   /protein_id="ADI03696.1"
FT                   /translation="MSELTRSEESATRNGISSTEEAFANIQVCRQDVENTKANVGGAYG
FT                   GSDGQKYQDLLQSWDDQAEIISKNLNDVIDTLNETLRANNLTQGSQKDAVDQEYAQSKA
FT                   IFDALHG"
     gtgtcagaac tgacgaggtc agaagagagc gcaacccgca acggaatctc ttccacggaa        60
     gaggcgttcg ccaacatcca ggtctgccgc caggacgtcg agaacacgaa ggccaacgtg       120
     ggcggtgcct acgggggcag cgacggtcag aagtaccagg acctgctgca gtcctgggac       180
     gaccaggccg aaatcatctc gaagaacctc aacgacgtca tcgacacgct gaacgagacg       240
     ctccgggcga acaatctgac gcagggttcg cagaaggacg ccgtcgacca ggagtacgcg       300
     cagtcgaagg cgattttcga cgcgctgcac ggctga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page