(data stored in ACNUC7421 zone)

EMBL: CP002047.PE576

CP002047.PE576       Location/Qualifiers
FT   CDS_pept        complement(729252..730703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03697"
FT                   /db_xref="GOA:D7C0K6"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K6"
FT                   /protein_id="ADI03697.1"
FT                   /translation="MQTKRDQVQAHMFVMGRLTSAMLRADPDAPESPQGRTNRAVTISV
FT                   LIGILLCAGAFVFGLLSPGTKSSWRDPGTLVINKETGTRYLYLGGRLRPVRNHTSARLL
FT                   AGDQMKVMTIGSKSLRGTPHGSPVGISGAPDEPPGNDNLTGDPWQVCSGNTSGATGTTV
FT                   AVGANADGAGLKSGQGLLVSGPDKEDYLVWQGRRLRLDQKANAAEALGYGSTKPVPVSA
FT                   AFLNSLPAGPDLAPSAVPGRGGQGPELGGLKTRVGQVFKVAAPGGTARYYLLRKEGLAP
FT                   LTATGAALVLGDPDTRQKAYAGGAVSPASLGADALSGHLAPDTPEVETGKRQPETPPEP
FT                   VDLGAGRTPCVGVESGSDGTRVSVALIRDVNLGPTAQAPPEGLVPACVTVNRITVRPGG
FT                   GALVHVLGAGGGEVGNTLYLVTDTGMKYRLPAADSLKALGYSEGEAQAIPSSLLAMLPT
FT                   GPDLTPQAASMGRSKSSAPRCETNK"
     atgcagacga agcgggatca ggtccaggcg catatgttcg tcatggggcg gctgacgtcc        60
     gccatgctgc gcgcggatcc cgacgccccg gagagccccc agggcaggac caaccgggcc       120
     gtgaccatca gcgtcctcat cgggatcctg ctctgcgccg gagcgttcgt cttcggcctg       180
     ctcagccccg gcacgaagag ttcctggcgg gacccgggca cgctggtcat caacaaggag       240
     accggtaccc gctacctgta cctgggcgga cggctgcgcc cggtgcgcaa ccacacctcg       300
     gcgcggctgc tcgcgggtga ccagatgaag gtcatgacca tcgggagcaa gtcgctgcgc       360
     ggcaccccgc acggctcgcc ggtcggcatc agcggcgccc ccgacgagcc gccgggcaac       420
     gacaacctga ccggcgaccc gtggcaggtg tgttccggca acaccagcgg agcgaccggc       480
     accacggtgg ccgtgggcgc caacgccgac ggcgcggggc tgaagtccgg gcaggggctg       540
     ctggtgagcg ggcccgacaa ggaggactac ctggtgtggc agggccgcag gctgcggctc       600
     gaccagaagg ccaacgccgc cgaagcgctc ggatacggct ccacgaagcc ggtgccggtc       660
     tcggccgcgt tcctcaactc cctgcccgcg ggcccggatc tggccccgtc ggccgtgccg       720
     ggccgaggtg ggcaggggcc ggaactgggc gggctcaaga cccgggtcgg ccaggtcttc       780
     aaggtcgccg cgccgggcgg caccgcccgc tactacctgc tgcgcaagga gggtcttgcc       840
     ccgctgaccg ccaccggcgc ggcgctggtc ctcggcgatc cggacacccg gcagaaggcg       900
     tacgcgggcg gggcggtgtc gcccgcgagc ctgggcgccg acgcgctgag cggccatctg       960
     gccccggaca cgccggaggt ggagacgggg aagcggcagc cggagacccc gccggagccg      1020
     gtggacctcg gtgccggacg gacaccatgt gtcggggtgg agtccgggag cgacggtacg      1080
     cgggtgagcg tggccctgat ccgcgacgtg aatctcggcc cgaccgcgca ggccccgccg      1140
     gaggggctcg tcccggcgtg tgtgacggtt aaccggatca cggtgcggcc aggcggaggc      1200
     gcgctggtgc atgtgctggg cgcgggcggc ggcgaggtcg gcaacacgct ttacctggtg      1260
     acggacaccg gaatgaaata ccggctgccc gcggccgatt ccctgaaggc gctgggatac      1320
     agcgagggcg aggcgcaggc cattccgtcc tcactgctgg ccatgctgcc aacgggtccg      1380
     gatctgactc cacaggcggc gagcatgggg cggagtaaat cctcggcgcc gcggtgtgaa      1440
     acgaataaat ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page