(data stored in ACNUC7421 zone)

EMBL: CP002047.PE577

CP002047.PE577       Location/Qualifiers
FT   CDS_pept        complement(730736..732136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03698"
FT                   /db_xref="GOA:D7C0K7"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K7"
FT                   /protein_id="ADI03698.1"
FT                   /translation="MTDTQVADLCRLTVRAPAKSVDLAVPSDVPVADLLPAVLGYGGED
FT                   LGEDGVDHGGWVLQRLGGGPMDEERTLDSYDLRDGETLYLRPRTEALPEAHLDDLVAGI
FT                   SDTMRSRPYGWTPEASRRLLLGLAVTVLTAGLVVLALPGGSVGVRAVCAAVTGLLLVAG
FT                   AGAASRAVGDAGAGATLGFMAAPYLAFAGWLLPGGDITGAHANEVVGSRLLASCVAGAG
FT                   GAIVVLAAVAAYAALFLGTGVVAVFGAITGTLMITADLAPHHVAGIIALAAVVLGAFVP
FT                   SLSFRMSGLKVPPLPTNAQQLQEGIEPHPTAAVAGRTALADGWMSSLYGAVGATCAACL
FT                   GALAWYANLPSVLTVVVLSLLLMLHARGLGNTWQRLSLTLPGVAGLLLLILVGAESYAP
FT                   DRRPLVAAGLLGLTAVIAIVSWTVPGRRLVPYWGRAAEILHYLMALSLLPLVLWALGVY
FT                   SALRGLMA"
     atgactgaca cccaggttgc cgacctgtgc cggctgaccg tccgcgcgcc cgccaagagc        60
     gtcgatctgg cggtgccctc cgatgtcccc gtggccgact tgctgcccgc cgtcctcggc       120
     tacggcggcg aggaccttgg cgaggacggc gtcgaccacg gcggctgggt gctgcagcgc       180
     ctcggcggcg ggccgatgga cgaggagcgc accctcgact cgtacgattt gcgcgacggc       240
     gaaacgctct acctccggcc gcgtaccgag gcgctgcccg aggcccacct cgacgacctc       300
     gtggccggca tctcggacac catgcggtcc cgcccctacg gttggacccc cgaggcgagc       360
     cggcggctgc tgctcggcct cgcggtgacc gtgctcaccg ccgggctcgt ggtgctcgcc       420
     ctgcccggcg gctccgtggg ggtgcgcgcc gtgtgcgccg ccgtgaccgg actgctgctg       480
     gtcgcgggcg cgggggcggc gagccgcgcg gtcggcgacg ccggagcggg cgccacgctc       540
     ggcttcatgg ccgcgcctta cctggcgttc gccggatggc tgctgcccgg cggcgacatc       600
     accggcgcgc acgccaacga ggtcgtgggc tcccggctgt tggcgtcctg cgtggcgggc       660
     gcgggcggcg cgatcgtcgt gctcgccgcc gtggccgcgt acgccgcgct cttcctgggc       720
     accggcgtgg tcgcggtgtt cggcgccatc accgggaccc tcatgatcac cgcggacctg       780
     gcgccgcacc atgtcgccgg gatcatcgcc ctggcggcgg tggtgctcgg cgcgttcgtc       840
     ccctcgctgt ccttccggat gtcggggctg aaggtgccac cgctgccgac caacgcccag       900
     cagctccagg agggcatcga accgcacccg accgcggcgg tcgccggccg cacggcgctc       960
     gcggacggct ggatgagttc gctgtacggg gcggtcggcg ccacctgcgc cgcctgcctc      1020
     ggggcgctcg cctggtacgc caacctcccc tcggtgctca cggtggtggt gctctcgctg      1080
     ctgctgatgc tgcacgcgcg gggtctgggc aacacctggc agcggctctc gctgaccctc      1140
     cccggcgtgg ccgggctgct cctgctgatc ctcgtcggcg cggagtcgta cgcaccggac      1200
     cgccggccgc tggtggccgc cggactgctc ggcctcacgg cggtcatcgc catcgtctcc      1260
     tggaccgtac cggggcggcg cctcgtcccg tactggggac gggcggccga gatcctgcac      1320
     tacctgatgg cgctcagttt gttgcccctg gtcctgtggg cgctcggcgt ctacagcgcc      1380
     ctccgcgggc tgatggcgtg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page