(data stored in ACNUC7421 zone)

EMBL: CP002047.PE578

CP002047.PE578       Location/Qualifiers
FT   CDS_pept        732514..736476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00578"
FT                   /product="putative FtsK/SpoIIIE family protein"
FT                   /note="COG1674 DNA segregation ATPase FtsK/SpoIIIE and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03699"
FT                   /db_xref="GOA:D7C0K8"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0K8"
FT                   /protein_id="ADI03699.1"
FT                   /translation="MVLFRRPARRRGPDMPEGELNLQEPPTLPEEVPDSSAVWTYLPMA
FT                   LMSVSMMLMFMRPGMSRSSGSHFMYLAVGMMVLASGAMMLGQMMRKISERKQRLKGERR
FT                   DYLRYLTQIRRKVRTAVADQKKALAWRHPDPAALWALVGTTRLWERRPQDEDFGEVRVA
FT                   VGEQKLGLRLTPKATTPVEDLEPLAAHALRSFIRAYSTVPDQPIAIYLRSWARVLFRGD
FT                   EERIRSVARAVIAQLVTFHAPDDIWVALCVSDERRADWEWVKWLPHNLHPQESDGAGQA
FT                   RMCVSAFNELEDLLGAEFLERPAFDPDAAAGREEPFTVIVVDGGSVPGGHRLDGPGFRN
FT                   AVVLDLSGALTWRPGRVTLRFEVSGQDFTLVRTDRERKEQPTRLGRPDRFGPLGVTALA
FT                   KRIAPYRMGMGSEVAEPLAANVELTTLLGISDLRRHDPATLWQRNTGSARLRVPIAVCA
FT                   DGTPLELDIKESAQGGTGPHGMLIGATGSGKSELLRTLVLALALSNSSETLNFVLVDFK
FT                   GGATFLGLDELPHTSAVITNLAGEAALVSRMQDAVHGELMRRQELLRAAGNYTSALDYE
FT                   KARASGTPLTPLPSLFIVVDEFSELLAAHREFMDLFVMIGRLGRSLGVHLLLASQRLDE
FT                   GRMHQLESHLSYRIGLRTFSAMESRGVLGVPDAYQLPPRPGSGYLKSGVEALMRFRAAY
FT                   VSGPYQERRAGANQARVASQTMPWTSGYVVPRQLSDLPEPEPEEELEETGDTLLSVAVE
FT                   RLLTAGPPAHQLWLPPLDLPATLDQVLPPLTPDPDLGLTTVGWPGRGRLTVPIGIVDKP
FT                   FEQLRDLLTIDLSGVGGHVAIAGGPQSGKSTLVRTILTALALTHSPREVSFFCLDFGGG
FT                   ALAGLAELPHTAGVAARLDTERVGRTIAEVNSLLAARERYFLDHGIDSMATYRRRRAAG
FT                   EFADQPYGDVFLVIDGWSTVRQDFDQHMQTFNSMAARGLNYGIHLIVTTARWVELSAGV
FT                   RDQAGTHLELRMGDSMDSEINSRRAATVPRLPGRGLTRDGMLHYLSALPRIDGMESSED
FT                   LADGVAGLVAAVKESWPGPRTPQVRMLPTKLPVSQLPPPEGDLRMPIGLEESELSTVWH
FT                   DFSETPHMIVVGDTESGKTNMLRLTAKAIMERYTPAEARIMVVDYRRTLVEAIPDEYRL
FT                   GHAVSVDALRDMIGGAAPAVKERVPGPDIAPGRMKLCDWWTGPRLFILVDDYDMVGGDS
FT                   MNAPFEPLLAHLALGYEVGLHLVVARSAAGASRGLNDRLLRRMLEVNTPGLLLSCPPAE
FT                   GYLFGNIKGRVLAAGRATRIARHKTTQVQTALVDEG"
     gtggtcctgt tccgccggcc ggcccgccgc cgtggcccgg acatgcccga gggcgagctg        60
     aacctccagg agccgcccac gctgcccgag gaggtgcccg acagctccgc cgtgtggacg       120
     tacctgccga tggcgctgat gtcggtgtcg atgatgctga tgttcatgcg gccgggcatg       180
     agccgttctt ccggaagcca cttcatgtac ctggccgtcg gcatgatggt gctggcctcc       240
     ggcgccatga tgctcggcca gatgatgcgc aagatcagtg agcgcaagca gcgtctcaag       300
     ggcgagcgcc gcgactacct gcgctatctc acgcagatcc ggcgcaaggt gcgcaccgcg       360
     gtcgccgacc agaagaaggc cctggcctgg cgccaccccg accccgcggc cctgtgggcg       420
     ctggtgggca ccacccggct gtgggaacgc cgcccgcagg acgaggactt cggcgaggtc       480
     cgggtggccg tcggcgagca gaagctcggc ctgcggctga cgccgaaggc caccacgccg       540
     gtggaagacc tggagccgct ggccgcgcac gccctgcgca gcttcatccg ggcgtactcc       600
     accgtgcccg accagcccat cgccatctat ctgcggtcct gggcgcgggt gctgttccgc       660
     ggcgacgagg agcggatacg ttccgtcgcc cgcgcggtga tcgcccagtt ggtgaccttc       720
     cacgcacccg acgacatatg ggtggcgctg tgcgtgtccg acgagcggcg ggcggactgg       780
     gaatgggtga agtggctgcc gcacaacctc cacccccagg agagcgacgg cgcgggccag       840
     gcccgcatgt gcgtctcggc cttcaacgag ctggaggacc tgctcggcgc cgagttcctg       900
     gagcggccgg ccttcgaccc ggacgcggcg gccgggcgtg aggagccgtt caccgtgatc       960
     gtggtggacg gcgggagcgt ccccggcggg caccggctgg acgggccggg cttccgcaac      1020
     gccgtcgtac tggacctgag cggcgcgctg acctggcggc ccggccgggt cacgctccgc      1080
     ttcgaggtgt ccgggcagga cttcacgctg gtccgtaccg accgggagcg caaggagcag      1140
     cccacccgac tcggccgccc cgaccggttc ggaccgctgg gcgtcaccgc gctggccaag      1200
     cggatcgccc cgtaccggat gggtatgggc agcgaggtcg ccgaaccgct ggcggcgaat      1260
     gtggagttga ccaccctgct ggggatcagc gacctgcgcc ggcacgaccc tgccacgctg      1320
     tggcagcgca acaccggctc cgcccggctg cgggtgccga tcgcggtgtg cgccgacggc      1380
     accccgctgg agctggacat caaggagtcc gcccagggcg gcacggggcc gcacggcatg      1440
     ctcatcggcg ccaccggctc cggcaagagc gagctgctgc gcaccctggt gctggcgctc      1500
     gcgctgtcca actcctccga aacgctcaac ttcgtcctgg tcgacttcaa gggcggcgcc      1560
     accttcctcg gcctggacga actgccgcac acctcggcgg tgatcaccaa cctggcgggc      1620
     gaggcggcac tggtctcccg gatgcaggac gccgtgcacg gcgagctgat gcggcggcag      1680
     gagctgctgc gggctgcggg caactacacc tccgcgctgg actacgagaa ggcgcgggcg      1740
     tccggcaccc cgctgacgcc gctgcccagc ctgttcatcg tcgtcgacga gttcagtgag      1800
     ctgctggccg cgcaccgcga gttcatggac ctgttcgtga tgatcgggcg gctcgggcgg      1860
     agcctcggcg tgcatctgct gctcgcctcg cagcggctcg acgagggccg gatgcaccag      1920
     ttggagagcc acctgtcgta ccgcatcggg ctgcgcacgt tctccgccat ggagagccgt      1980
     ggcgtgctcg gcgtgcccga cgcctaccag ctgccgccgc ggcccggcag cggctatctg      2040
     aagtccggtg tggaggcgct gatgcggttc cgcgcggcgt acgtctccgg cccgtaccag      2100
     gagcggcggg ccggcgcgaa ccaggcccgg gtggccagcc agaccatgcc gtggacctcc      2160
     ggttatgtgg tgccgcgcca gctgtccgac ctgcccgagc cggagcccga ggaggagttg      2220
     gaggagacgg gcgacacgct gctgtccgtc gcggtggagc ggctgctcac cgcggggccg      2280
     cccgcccacc agttgtggct gccgccgctg gacctgcccg cgaccctcga ccaggtgctg      2340
     cccccgctca cccccgaccc cgacctgggg ctgaccaccg tcggctggcc ggggcggggg      2400
     cggctgaccg tcccgatcgg catcgtggac aagcccttcg agcagctgcg ggacctgctg      2460
     acgatcgacc tgtcgggcgt cggcgggcac gtggccatcg cgggcggccc gcagagcggc      2520
     aagtccaccc tggtgcgcac catcctcacc gcgctcgcgc tcacccactc cccgcgcgag      2580
     gtgtcgttct tctgcctgga cttcggcggc ggcgcgctgg cgggcctggc ggagctgccg      2640
     catacggccg gggtggcggc tcggctggac accgagcggg tgggccggac gatcgcggag      2700
     gtcaactcgc tgctggccgc gcgcgagcgg tacttcctcg accacggcat cgactccatg      2760
     gccacctacc ggcgccgccg ggccgccggg gagttcgcag accagcccta cggggacgtg      2820
     ttcctggtca tcgacggctg gtcgacggtg cggcaggact tcgaccagca catgcagacg      2880
     ttcaactcga tggccgcccg cggcctcaac tacggcatcc acctgatcgt caccaccgcc      2940
     cgctgggtgg agctgtccgc gggcgtgcgc gaccaggccg gcacccatct ggagctgcgg      3000
     atgggcgact cgatggactc cgagatcaac agccgccgcg cggccaccgt gccgcggctg      3060
     cccggccgcg gtctgacccg ggacggcatg ctgcactacc tctccgcgct gccccgtatc      3120
     gacgggatgg agagctcgga ggaccttgcg gacggggtcg ccggcctggt cgcggcggtc      3180
     aaggagagct ggccggggcc gcggaccccg caggtgcgga tgttgccgac caaactgccg      3240
     gtctcccagc tcccgccgcc cgagggcgat ctgcggatgc cgatcggcct ggaggagagc      3300
     gaactgtcca cggtgtggca cgacttcagt gagaccccgc acatgatcgt cgtcggcgac      3360
     accgagagcg gcaagaccaa catgctgcgg ctgacggcca aagcaatcat ggaacggtat      3420
     acgcccgccg aggcgcggat catggtcgtg gactaccgcc gcaccctggt ggaggccatc      3480
     cccgacgagt accgcctcgg ccacgcggtc tccgtcgacg cgctgcgcga catgatcggc      3540
     ggggcggccc cggcggtcaa ggagcgggtg ccgggaccgg acatcgcccc gggccggatg      3600
     aagctgtgcg actggtggac gggcccgcgg ctgttcatcc tggtcgacga ctacgacatg      3660
     gtgggcggcg actcgatgaa cgcgccgttc gaaccgctgc tggcgcacct cgcgctcggc      3720
     tacgaggtcg ggctgcacct ggtcgtggcc cgctccgcgg cgggtgcctc gcgcggcctc      3780
     aacgaccgcc tgctgcggcg gatgctggag gtcaacaccc ccggtctgct gctgtcctgc      3840
     ccgccggcgg agggctacct cttcggcaat atcaagggcc gggtgctggc ggcggggcgg      3900
     gccacgcgca tcgcccgtca caagacgacg caggtgcaga ccgcgctggt tgacgagggg      3960
     tag                                                                    3963
//

If you have problems or comments...

PBIL Back to PBIL home page