(data stored in ACNUC7421 zone)

EMBL: CP002047.PE582

CP002047.PE582       Location/Qualifiers
FT   CDS_pept        complement(742010..742684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00582"
FT                   /product="putative transcriptional regulator, TetR family
FT                   protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03703"
FT                   /db_xref="GOA:D7C0L2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L2"
FT                   /protein_id="ADI03703.1"
FT                   /translation="MSAMATEKRPAGGMSERRRTRLRLEISREAARLFWKQGVAATSGD
FT                   QIADAVGLSTRTIWRHFRSKEACAEPIVMQGVVTLMSVLHSWPKDSSLEDHLAGELVRL
FT                   QYETRPVDLTDEMLAMKMIRLADTEPALRTAWLMACDQTEQQLRVIIGDRLGRPAGDLE
FT                   VRLHAAATAAVVRVLDEQIGVAFLADAGAGATELTEVKAAAGRFAHAIRAATGGAVGDP
FT                   IA"
     atgagtgcca tggcgacgga gaagcgccct gcgggaggga tgagcgagcg gcggcgtacg        60
     cggctgcggc tggagatctc ccgggaggcg gcgcgcctgt tctggaagca gggtgtggcg       120
     gcgaccagcg gcgaccagat cgccgacgcg gtcgggttgt ccacgcgcac catctggcgg       180
     cacttccgca gcaaggaggc gtgcgccgag ccgatcgtca tgcagggcgt cgtcaccttg       240
     atgagcgtgc tgcacagctg gccgaaggac agctccctcg aagaccacct ggcgggcgaa       300
     ctggtccggc tccagtacga gacacggccg gtcgatctga ccgacgaaat gctggcgatg       360
     aagatgatcc ggctcgccga caccgaaccg gcgctccgca cggcctggct gatggcctgt       420
     gaccagaccg aacagcagct gcgcgtgatc atcggcgacc ggctggggcg cccggccggc       480
     gatctggagg tacggctgca cgccgcggcc accgctgcgg tggtgcgggt gctggacgag       540
     cagatcggcg tcgccttcct cgccgacgcc ggcgccggcg ccacggaact gaccgaggtg       600
     aaggccgccg ccgggcggtt cgcccacgcg atccgcgcgg ccaccggcgg ggccgtcggc       660
     gaccccatcg cctga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page