(data stored in ACNUC7421 zone)

EMBL: CP002047.PE583

CP002047.PE583       Location/Qualifiers
FT   CDS_pept        complement(742767..743465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00583"
FT                   /product="hypothetical protein"
FT                   /note="COG0285 Folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00583"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03704"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L3"
FT                   /protein_id="ADI03704.1"
FT                   /translation="MSSVRDTRIRLLTATAAVAIAALSLTACSDGSGEHDEGSSAGGSS
FT                   TGSFSGKDAKSSGAGSGQDGDAPAGKDFVAGGNGKTGTGDSRASGNKAVACKGSNTKTV
FT                   AAPVNKPVNHMLLTVINTGSAPCDLYGYPAARFGEAQSVPPVYEDSKPQAVVTLAPGEP
FT                   GYAAVNLSATDGSGTNGHTVKSLAVAFQDRTGEGTSWVAHPSLPAEGIYVDDSLCVTYW
FT                   QQSMDNALSW"
     atgtccagtg tccgggacac ccgcatccgc ctgttgaccg ccaccgcagc tgtcgcgatc        60
     gccgctctct ccctgaccgc gtgcagcgac gggtcgggtg agcatgacga gggctcgtcg       120
     gcaggcggct cctcgaccgg ctcgttctcc ggtaaggatg cgaagtccag cggcgccggt       180
     tcggggcagg acggggacgc gcccgcgggg aaggacttcg tggcgggagg gaacggcaag       240
     accggcaccg gcgactccag ggcgagtggc aacaaggccg ttgcctgcaa gggctccaac       300
     accaagacgg tcgcggctcc cgtgaacaag cccgtgaacc acatgctgct cacggtcatc       360
     aacaccggca gcgccccctg cgacctctac ggctatccgg ccgcccgctt cggcgaggcc       420
     cagtcggtgc cgccggtcta cgaggactcc aagccgcagg ccgtcgtcac gctcgccccg       480
     ggcgagcccg gctacgccgc cgtgaacctg tcggccaccg acggcagcgg cacgaacggc       540
     cacaccgtga aatccctcgc cgtcgccttc caggaccgca ccggagaggg cacttcctgg       600
     gtcgcccacc cgtctctgcc cgccgagggc atctacgtgg acgactccct ctgcgtcacg       660
     tactggcagc agtcgatgga caacgccctc agctggtaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page