(data stored in ACNUC7421 zone)

EMBL: CP002047.PE584

CP002047.PE584       Location/Qualifiers
FT   CDS_pept        743663..744994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00584"
FT                   /product="DNA-binding protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00584"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03705"
FT                   /db_xref="GOA:D7C0L4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L4"
FT                   /protein_id="ADI03705.1"
FT                   /translation="MSGSIGGTGATGPTEDAEAFAELLRRLKERSGLSYGALAKRLDMS
FT                   TSTLHRYCNGRAVPNDYAPVERLARVCRATGEELVELHRRWILADAARVRRGPGPDGTE
FT                   PEGAGPGGSGSEKMAPGSTGSEPRKPSESDEPVVSGATPSAPARSRRRQTALIASVAAA
FT                   AALATVTLTAILSEDDERIPAGDTTVSSVTLPADGTSPTDDTSPPASGSSSPSQRAKNG
FT                   KPSASKSAEHTGGVTTERSDAVPVKVTARPYVYDNPCNQHFLVDSEPEQVGPPAVEQDA
FT                   PRWAAAYGAVPAGNQRIALSVQGTGKDTVVLEALHVRVTAKGAPLAWNDYGMGVVCGGG
FT                   GAVVKPESFDVDLDDGSPTVTVKNGQRDFPYKVSESNPEVFYVTAHTRGHDVRWDLALD
FT                   WSSGDRHGTLHINNNGTSFRTSANAGRPGYNYQPGSNEWTKRGG"
     gtgtcagggt cgataggggg caccggagcg accgggccca ccgaggatgc ggaagcgttc        60
     gcggagctgc tgcggagact caaggaacgc tcggggctga gctacggggc acttgccaag       120
     cggctggaca tgagcacctc gacgctgcac cgctactgca acggccgcgc ggtgccgaac       180
     gactatgcgc cggttgagcg gctcgcccgg gtgtgccggg cgaccggcga ggagctggtc       240
     gagctgcacc ggaggtggat tctggcggac gcggcgcggg tgcgcagggg gccgggtccg       300
     gacggaacag agccggaggg agcggggccg ggcgggtcgg gatcggagaa aatggcgccg       360
     ggatccaccg gcagcgaacc ccgcaaacca agtgagagtg acgagccagt cgtcagcggc       420
     gccacgccgt ccgcccccgc gcgctcccgc cggcgccaga ccgcgctcat cgcctccgtc       480
     gccgcggccg ccgctctggc aaccgtcacg ctcaccgcga ttctctccga agacgacgaa       540
     cggatacccg ccggggacac caccgtgtcc agcgtcaccc tcccggcgga cggcacaagc       600
     ccgacggacg acacaagccc gcccgcctcg ggctcctcgt ccccgtccca gcgtgcgaag       660
     aacggcaaac cctcggcgtc gaagtccgcc gagcacaccg gcggggtcac caccgagcgc       720
     tccgacgccg tacccgtcaa ggtcaccgcc cggccctacg tctacgacaa cccgtgcaat       780
     cagcacttcc tcgtcgacag cgagcccgaa caggtcggcc cgcccgccgt cgagcaggac       840
     gcgccccgct gggccgccgc gtacggcgcg gtccccgcgg ggaatcagcg catcgccctg       900
     tccgtgcagg gcaccgggaa ggacaccgtc gtcctggagg cgctgcacgt acgcgtcacc       960
     gcgaagggcg ccccgctcgc ctggaacgac tacggaatgg gtgtcgtctg cggcggcggc      1020
     ggtgccgttg tcaaacccga gtcgttcgac gtcgatctcg acgacggcag ccccaccgtc      1080
     accgtcaaga acggccagcg cgacttcccg tacaaggtca gcgagtccaa cccggaagtc      1140
     ttctacgtca ccgcccacac cagagggcac gacgtccgct gggacctcgc cctggactgg      1200
     tccagcggcg accgccacgg caccctgcac atcaacaaca acggcacctc gttccgcacc      1260
     agcgccaacg ccggccgccc cggctacaac taccagccgg gcagcaacga gtggaccaag      1320
     cgggggggct ag                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page