(data stored in ACNUC7421 zone)

EMBL: CP002047.PE587

CP002047.PE587       Location/Qualifiers
FT   CDS_pept        complement(748773..749597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00587"
FT                   /product="sugar transport integral membrane protein"
FT                   /note="COG0395 ABC-type sugar transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03708"
FT                   /db_xref="GOA:D7C0L7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L7"
FT                   /protein_id="ADI03708.1"
FT                   /translation="MIAMPARTLRRGSNTVIALVVLAILLFPLYWMLNIALQPGESLAS
FT                   TSWFPTSPGWSNFERALDSQGGSLVTSLVVALGAVVVCLAMAAPAAYGLAQLGLRGGRS
FT                   IVFGTLITQMVPGIVIANALYSAYVDLHLVNSLPGLILADASLGLPFSIVLLRAFMVSI
FT                   PKEIVEAAMVDGANRFTAFVRIVLPISRNSLITAGLFTFLFAWSDFMFALTLNTTDDVK
FT                   PITLSMYEYIGAHVSDWGAVMATAVVSAVPAAILLILAQKYVAAGITGGSVK"
     gtgatcgcca tgcccgcccg caccctgcga cggggcagta acaccgtcat cgcgctggtc        60
     gttctggcca ttctgctctt ccccctgtac tggatgctca acatcgccct tcagccgggc       120
     gaaagtctcg cctcgaccag ctggttcccc acctcgccgg gctggtcgaa cttcgagcgg       180
     gcgctggaca gccagggcgg ctcactcgtg accagcctgg tcgtcgcgct cggcgcggtc       240
     gtggtctgtc tcgcgatggc cgcgcccgcc gcctacggcc tggcccagct cggcctgagg       300
     ggcggccggt ccatcgtgtt cggcaccctg atcacccaga tggtgcccgg tatcgtgatc       360
     gccaacgcgc tctacagcgc ctatgtcgac ctgcacctgg tcaactcgct ccccgggctg       420
     atcctggccg acgcctcgct cggactgccg ttctccatcg tgctgctgag ggcgttcatg       480
     gtgtccatcc cgaaggagat cgtggaagcg gcgatggtcg acggggcgaa ccgattcacc       540
     gccttcgtcc gcatcgtgct cccgatcagc cgtaactcgc tcatcacggc cgggctcttc       600
     accttcctct tcgcctggtc cgacttcatg ttcgcgctga cgctcaacac gacggacgac       660
     gtcaagccga tcaccctcag catgtacgag tacatcggcg cccacgtcag cgactggggc       720
     gcggtcatgg ccacggccgt cgtctccgcc gtcccggcgg cgatcctgct gatactggcc       780
     cagaagtacg tcgccgcggg catcaccggc ggttcggtca agtag                       825
//

If you have problems or comments...

PBIL Back to PBIL home page