(data stored in ACNUC7421 zone)

EMBL: CP002047.PE588

CP002047.PE588       Location/Qualifiers
FT   CDS_pept        complement(749594..750547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00588"
FT                   /product="sugar transport integral membrane protein"
FT                   /note="COG1175 ABC-type sugar transport systems, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03709"
FT                   /db_xref="GOA:D7C0L8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L8"
FT                   /protein_id="ADI03709.1"
FT                   /translation="MSTTTAVPAKSVAASPAVPGRRASRAALTRWLFVAPAVLYMLAFF
FT                   GYPLVRNVVMSFQHYTPRTFFTGEAPFNGLDNWTAVFGNELFTESLWHTAVFTLGSLLG
FT                   QFVLGLALAVFFSRRFRLSGFARAVLLLPWLIPMVVSSVVWRKLLDQDTGVLNTLLMNL
FT                   HLTSEPVPWLSSPSVALLSAILVNIWVGIPFNMVILYGGLQEIPREMYEAASLDGAGPW
FT                   RTFRSITLPQLRPVITVVLVLGFMSTIKILDLILALTGGGPADSTQTLGTATYQLSFQQ
FT                   LDFGQGAVVGNVLILISAVFAVFYLRANRSDFGQGK"
     atgagtacca ccactgccgt gcccgccaag tccgtggcgg cgagccccgc ggtcccgggt        60
     cggcgagcgt cccgcgccgc gctgacacgc tggctcttcg tggcgcccgc cgtgctctac       120
     atgctggcct tcttcggata tccgctcgta cgcaacgtcg tcatgagctt ccagcactac       180
     acaccgcgta ccttcttcac cggcgaggca ccgttcaacg gcctcgacaa ctggaccgcg       240
     gtgttcggca atgagctgtt caccgaatcc ctctggcaca cggccgtctt cacactgggc       300
     tcactgttgg gtcagttcgt gctcggcctg gcgctggccg tgttcttctc ccggcgcttc       360
     aggctgtccg gcttcgcccg cgcggtgctg ctgcttccgt ggctcatccc gatggtcgtc       420
     tcgtcggtcg tctggcggaa acttctcgac caggacaccg gggtgctcaa caccctgctg       480
     atgaacctgc acctcacctc ggagccggtg ccctggctga gcagcccgag cgtcgccctg       540
     ctgtcggcga tcctggtcaa catctgggtc ggcatcccgt tcaacatggt gatcctctac       600
     ggcgggcttc aggagatccc gcgcgagatg tacgaggccg cctcgctgga cggcgccggt       660
     ccctggcgta cgttccgcag catcacgctg ccgcagttgc ggccggtgat cacggtggtc       720
     ctggtcctcg gttttatgtc gacgatcaag atcctggacc tgatcctcgc gctgaccggc       780
     ggcggaccgg ccgactccac acagactctg ggcaccgcca cctaccaact gtccttccag       840
     cagctcgact tcggtcaggg cgcggtggtc ggcaacgtcc tcatcctcat cagcgcggtg       900
     ttcgccgtgt tctatctccg ggccaaccgg tccgacttcg gtcaggggaa gtga             954
//

If you have problems or comments...

PBIL Back to PBIL home page