(data stored in ACNUC7421 zone)

EMBL: CP002047.PE589

CP002047.PE589       Location/Qualifiers
FT   CDS_pept        complement(750557..751789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00589"
FT                   /product="sugar transport sugar binding protein"
FT                   /note="COG1653 ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00589"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03710"
FT                   /db_xref="GOA:D7C0L9"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D7C0L9"
FT                   /protein_id="ADI03710.1"
FT                   /translation="MPLLRRRPPAPVLLLTLLVASAGLTGCAREADPNTITVLNSATDK
FT                   HEHDQQQKFFDRCAEPLGVKVEQTSVPAAQVATKALRMASSHSMTDILELDGSELPQFA
FT                   DTGGLVPLKTAGVAVDGLSPGAVSMGSFKGTAYGIARSVNTLALFYNTDVLKEAGVTPP
FT                   ATWDELKVAAKKLTRGKMFGMAFSATPDADGVYQFLPFFWSAGGDEARIDNGKGEQAVQ
FT                   LWKDLVTDRSASSAVVTWNQQDVNDQFIAGRTAMMVNGPWQVPVLSQHKSLHWAVTTIP
FT                   VPVAGKAPVAPMGGTVMTLPRTGDTGRQATAAKILNCLNERRNQVGWGAGVNNIPTRAS
FT                   AAAEYKADNPKLAGFADTVATARSRTAKVGARWPAVSSALAGAFQSVLTGSSSPEAALK
FT                   RAQSQATAGGE"
     atgccattgc ttcgccgccg cccgccggcg ccggtcctgc tcctgaccct ccttgtggcc        60
     tcggccggcc tcaccgggtg tgcgcgggag gccgacccca acaccatcac ggtgctgaac       120
     tccgccacgg acaagcacga gcacgaccag cagcagaagt tcttcgaccg gtgtgccgag       180
     cccctcgggg tgaaggtcga gcagaccagt gttcccgccg cccaagtggc gaccaaggcg       240
     ctgcggatgg cgtcgtcgca ctcgatgacc gacatcctgg agctggacgg atcggagctg       300
     ccgcagttcg cggacaccgg tggtctggtc ccgctgaaga cggcgggcgt ggcggtggac       360
     gggctctcgc caggggccgt gagcatgggg agtttcaagg gcaccgcgta cggcatcgcc       420
     cgctcggtca acaccctggc gctgttctac aacacggacg tgctgaagga ggcgggggtg       480
     acaccgcccg ccacatggga cgagctgaag gtggcggcca agaagctcac ccggggcaag       540
     atgttcggga tggctttcag cgcgacaccc gacgccgacg gggtgtacca gttccttccc       600
     ttcttctggt ccgcgggcgg cgacgaggcc cgcatcgaca acggcaaggg cgaacaggcg       660
     gtccagctgt ggaaggacct ggtcaccgac cggtccgcgt caagcgccgt ggtcacctgg       720
     aaccagcagg atgtcaacga tcagttcatc gcgggccgga cggccatgat ggtcaacggc       780
     ccttggcagg ttcccgtgct cagccagcac aagtccctgc actgggcggt caccaccatc       840
     ccggtgcccg tggccggcaa ggctccggtg gcgccgatgg gcggaaccgt gatgaccctg       900
     ccccgtaccg gcgacaccgg gcgccaggcc accgccgcca agatcctcaa ctgcctgaac       960
     gagcgacgga accaggtggg ctggggtgcg ggcgtgaaca acatccccac cagggcctcc      1020
     gccgccgccg agtacaaggc cgacaatccg aagctcgcgg gcttcgccga caccgtcgcc      1080
     accgcccgtt cccgtaccgc caaggtcggc gcccggtggc cggccgtctc cagcgccctg      1140
     gcgggcgcct tccagtctgt actgaccggt agctcctcgc ccgaagcggc gctgaagcgt      1200
     gcccagtcgc aggccacggc cggcggagag tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page