(data stored in ACNUC7421 zone)

EMBL: CP002047.PE59

CP002047.PE59        Location/Qualifiers
FT   CDS_pept        55000..55296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03180"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUI9"
FT                   /protein_id="ADI03180.1"
FT                   /translation="MTEDAGQGWRWEYEPDYEYVAKGLPKRVVVEVERLAGQLVDLAEM
FT                   GIDVTAVGDGPRPGVAGGVRRLSVLEDGFMLVLPLPRLRLVAVTYICPPFADL"
     gtgaccgaag acgccggaca ggggtggcgc tgggagtacg agcccgacta cgagtacgtg        60
     gcgaaggggt tgcccaagcg cgtggttgtg gaggtggagc ggctcgccgg gcagctcgtg       120
     gacctggccg agatgggcat cgacgtcacg gccgtagggg acggcccgag gccgggagtc       180
     gcaggcggcg tacggcgcct gtcggtcctg gaagacgggt tcatgctggt cctgcctctc       240
     ccccggctgc gcctcgtcgc cgtcacatac atctgccctc cgttcgccga cctgtag          297
//

If you have problems or comments...

PBIL Back to PBIL home page