(data stored in ACNUC7421 zone)

EMBL: CP002047.PE591

CP002047.PE591       Location/Qualifiers
FT   CDS_pept        complement(753234..754829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00591"
FT                   /product="transcriptional regulator, PucR family protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03712"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D7C258"
FT                   /protein_id="ADI03712.1"
FT                   /translation="MQLTIREVLALPVMAAGRPRVIGGRDHLDRPVRWVHISDLTDLTD
FT                   LLEGGELVLTTGLPLSGGAREASAYLTMLAEQDVAGLVIELGTHLKAVPDYLGTLADSV
FT                   RLPVVVLSATIRFIEVTQQVHRLIVADQYDEVEFARTTHEVFTSLNIARASTTDIVTRA
FT                   AQTLGAPLVLEDLGRHVLAFCAVDTPTAQLLYQWAERSRLHASADTPTGSAWSAVSVGV
FT                   GSERWGRLVLPARTPNASRARMVLERAAQSLQLHRMIQQERDALVVHAHGGLLDDLRGG
FT                   RINDGAEALARASALGLTPSTHYVPLSVRVPGRPDTDALTQGEVDRRLLTAVRQAVAAA
FT                   GQSAIVAIRREGTVSAIMSCSPKGADSALSAVCRGLRERLTGRGGTDGWAAGTAPASPS
FT                   LIAAAQGITEAEHVADVGLTMPETNRLYRSTDVRLRGLVALLRNDHRVQAFAETELGRL
FT                   LDHDARTGDNLLTLLRTHLDCAGSKTHTARLTGLSRPTLYSRLRTIERILDVSLESAES
FT                   RTSLHTALMIVDAR"
     atgcagctga cgatccggga agtcctcgcg ctgcccgtca tggccgcggg ccggccgcgg        60
     gtcatcggcg gccgggatca cctcgaccga ccggtccgct gggtccacat cagcgatctc       120
     accgacctca ccgatctgct cgagggcggt gaactcgtcc tgaccaccgg tctgcccctg       180
     tccggcggtg cccgtgaggc gtccgcctac ctgaccatgc tggccgagca ggacgtggcg       240
     ggactcgtca tcgaactggg cacccacctc aaggcggtgc ccgactatct ggggaccctg       300
     gccgactcgg tccggctccc ggtggtggtc ctgtccgcca cgatccgctt catcgaggtc       360
     acccagcagg tacaccggct gatcgtggcg gaccagtacg acgaggtgga attcgcccgg       420
     accacccacg aggtcttcac ctcgctcaac atcgcccgcg cctccaccac ggacatcgtg       480
     acgcgcgcgg cacagaccct gggcgccccc ctggtactgg aagatctcgg ccggcatgtg       540
     ctggccttct gcgcggtgga caccccgacg gcgcaactgc tgtaccagtg ggccgaacga       600
     tcacgcctcc acgcctcggc ggacaccccc accggttcgg cctggtcggc cgtctcggtg       660
     ggcgtcggct ccgaacgatg gggccgactc gtcctgcccg cccgcacacc gaacgcgtcc       720
     cgcgcacgca tggtcctcga acgcgccgca cagtccctgc agctgcaccg gatgatccaa       780
     caggagcgcg acgccctcgt cgtccacgca cacggtggcc tcctggacga cctgcggggc       840
     ggccggatca acgacggcgc cgaggccctg gcacgggcga gcgccctcgg cctcaccccg       900
     agcacccact atgtgccgct gtccgtgcgg gtccccgggc ggcccgacac cgacgcactg       960
     acccagggcg aagtcgaccg ccgcctgctg accgccgtgc gtcaggcggt cgccgccgcc      1020
     ggtcagagcg cgatcgtcgc catccgccgg gaaggaaccg tctcggcgat catgtcgtgt      1080
     tcccccaaag gcgccgacag cgcgctgagc gccgtatgcc gcgggctgcg cgagcggctg      1140
     accggacgag gcggcacgga cggctgggcc gccggcaccg cacccgcctc cccgagcctc      1200
     atcgcggcgg cccagggcat caccgaggcg gaacacgtgg ccgacgtggg gctgaccatg      1260
     ccggagacca accgcctcta ccggtcgacc gacgtacgcc tgcgcgggct cgtcgccctc      1320
     ctccgcaacg accaccgcgt ccaggcattc gccgagaccg aactgggccg cctcctcgac      1380
     cacgacgccc gcacgggcga caacctcttg accctgctgc gcacccacct cgactgcgcg      1440
     ggctccaaga cgcacaccgc ccggctgacc ggcctgagcc gccccaccct ctacagccgc      1500
     ctgcggacca tcgaacgcat ccttgacgtc tcactggagt ccgccgaatc acggacctcg      1560
     ctccacaccg ccctcatgat cgtcgacgcc cgctga                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page