(data stored in ACNUC7421 zone)

EMBL: CP002047.PE593

CP002047.PE593       Location/Qualifiers
FT   CDS_pept        756485..757849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00593"
FT                   /product="hypothetical protein"
FT                   /note="COG0160 4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03714"
FT                   /db_xref="GOA:D7C260"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7C260"
FT                   /protein_id="ADI03714.1"
FT                   /translation="MTLVHPELNPQAIARTYELDRRHVFHSWSAQAEITPMVITRAEGS
FT                   YIWDGEGNRLLDFSSQLVNTNIGHQHPYVVEAIADQARTLATVAPQHANDQRSEAARLI
FT                   CERAPGELNRVFFTNGGADANEHAVRMARLTTGRPKVLSRYRSYHGGTQTAINLTGDPR
FT                   RWPNDEGTSGVVHFFGPYLYRSHFDATTEEEECRRALAHLEQVIELEGPQTIAAILLEA
FT                   IPGTAGIMPPPPGYLAGVRALCDQYGIVFIVDEVMTGFGRTGAWFVCDDEGVVPDLLTF
FT                   AKGVNSGYVPLGGVVISDRIAEHFAHRPYPGGLTYSGHPLACAAAVAAITVMERDGIID
FT                   NARRIGTDVFGPELVRLAAQHPSVGEVRGRGVFWAIELVTDRHTRRPVAPTGGSSPVMA
FT                   EAVRASKELGLLPFTNSGRIHLVPPCTITESEAREGLHIIDQVLSRVDTLCGASS"
     atgactctcg tccaccccga actcaacccg caggctatcg cccggaccta cgaactcgac        60
     cgccgccatg tcttccactc ctggtccgcc caggccgaaa tcacgcccat ggtcatcacc       120
     cgcgccgagg gttcctacat ctgggacggc gaaggcaacc ggctgctcga cttctcctcc       180
     cagctggtga acaccaacat cggccaccag cacccctacg tcgtggaagc gatcgccgac       240
     caggcccgca ccctggccac ggtggccccg cagcacgcca acgaccagcg ctccgaggcg       300
     gcccgcctga tctgcgaacg cgcccccggc gagctgaacc gggtgttctt caccaatggc       360
     ggtgccgacg ccaacgaaca cgccgtgcgc atggcccggc tgaccaccgg ccggcccaag       420
     gtactgagcc gctaccgctc gtaccacggc ggaacgcaga ccgcgatcaa cctgaccggg       480
     gacccgcgcc gctggcccaa cgacgaaggg acctcgggtg tggtccactt cttcggcccg       540
     tacctctacc ggagccactt cgacgcgacg accgaagagg aggagtgccg gcgggcactc       600
     gcacacctcg agcaggtcat cgaactcgag gggccgcaga ccatcgccgc gatcctgctg       660
     gaggccatcc ccggcacggc cggcatcatg ccgcccccgc ccggctatct cgcaggcgta       720
     agggcgctgt gcgaccagta cggcatcgtg ttcatcgtcg acgaggtgat gaccggcttc       780
     ggccgcaccg gcgcgtggtt cgtctgcgac gacgaaggcg tggtccccga cctgctgacc       840
     ttcgccaagg gcgtcaactc tgggtacgtc ccgctgggcg gtgtcgtcat ctcggaccgg       900
     atcgccgagc acttcgcaca ccgtccctac cccggcgggc tcacctactc cgggcacccg       960
     ctggcgtgtg cggcggccgt tgccgcgatc accgtcatgg aacgcgacgg catcatcgac      1020
     aacgcccgcc gcatcggcac cgacgtgttc ggccccgaac tcgtccggct cgccgcacag      1080
     caccccagcg tcggcgaagt ccgcggacgg ggcgtcttct gggccatcga gctcgtcacc      1140
     gaccggcaca cccgccggcc tgtcgcgccg accgggggca gcagcccggt gatggccgag      1200
     gccgtccgcg cctcgaagga gctcggactg ctgccgttca ccaactcggg ccgcatccac      1260
     ctcgtaccgc cgtgcaccat caccgaatcc gaggcccgcg aggggctgca catcatcgac      1320
     caggtcctga gccgggtcga cacgctgtgc ggtgcgtcgt catga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page