(data stored in ACNUC7421 zone)

EMBL: CP002047.PE596

CP002047.PE596       Location/Qualifiers
FT   CDS_pept        758954..759793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00596"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /note="COG1262 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03717"
FT                   /db_xref="GOA:D7C263"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D7C263"
FT                   /protein_id="ADI03717.1"
FT                   /translation="MGGDDADAFPEDGEGPVRAVRLSPFLIDATAVTNRQFAAFVRASG
FT                   YRTDAERYGWSYVFYALVHPGARHLVRDTVAQAPWWLAVEGACWQAPYGPGSSWTELSN
FT                   HPVVHVSWRDASAYAAWAGKRLPTEAEWERAARGGLERSRFPWGDELLPRGQHRCNIWQ
FT                   GRFPQVNTGEDGYLGTAPVKTFRPNNFGLYNTSGNVWEWCSDWWSTTWHAADRPETRQD
FT                   PAGPPAGEAKVIRGGSYLCHASYCNRYRVAARTSNTPDSSTGHMGFRCAADLPRTVR"
     atggggggcg atgacgccga cgcgtttccc gaggacggtg agggcccggt ccgggcggtg        60
     cggctgtcgc cgttcctcat cgacgccacg gctgtcacca acaggcagtt cgcggcgttc       120
     gtgcgtgcca gcggctatcg gaccgatgcc gagcgctacg gctggtccta cgtgttctac       180
     gcgctcgtcc accccggggc ccggcacctg gtgcgcgaca cggtggcgca ggcgccctgg       240
     tggctcgcgg tggagggggc gtgctggcag gccccgtacg ggccggggtc gtcatggacc       300
     gagctgtcga accaccccgt cgtccatgtc tcctggcgcg acgcgtccgc ctacgccgcc       360
     tgggcgggca agcgcctgcc caccgaggcg gagtgggaga gggcggcgcg tggcggtctg       420
     gagcgctccc gcttcccctg gggggacgaa ctgctgcccc gcgggcagca ccgctgcaat       480
     atctggcagg ggcggtttcc acaggtcaac acgggtgagg acggatatct gggcaccgcg       540
     ccggtcaaga ccttccggcc caacaacttc ggcctctaca acacctcggg caatgtgtgg       600
     gaatggtgct ccgactggtg gagcaccaca tggcacgcgg ccgaccgtcc ggagacccgc       660
     caggacccgg ccgggcctcc cgccggggag gcgaaggtga tccgcggcgg ctcctatctg       720
     tgccatgcgt cgtactgcaa ccgctaccgc gtcgccgcgc gcacctccaa cacaccggac       780
     agcagcaccg gacacatggg gttccgttgc gcggccgacc tgccccggac ggttcggtag       840
//

If you have problems or comments...

PBIL Back to PBIL home page