(data stored in ACNUC7421 zone)

EMBL: CP002047.PE60

CP002047.PE60        Location/Qualifiers
FT   CDS_pept        complement(55878..57026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00060"
FT                   /product="Beta-lactamase class C and other penicillin
FT                   binding protein-like protein"
FT                   /note="COG1680 Beta-lactamase class C and other penicillin
FT                   binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03181"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7BUJ0"
FT                   /protein_id="ADI03181.1"
FT                   /translation="MHVLGRRRRGPLVLTGLAAVLLAASTGLTAAAKPQQADPLQQQVD
FT                   AIHDTGAVGVLAEVTSPDTRDSARAGTAELGTGRPMPRNGRFRIGSAAKTFTATVVLQL
FT                   VGEGRMSLEDTVEQWLPGVVRGNDNDGSQITVRQLLQHTSGIRDVLPEIPALNSADGYR
FT                   AERFRTYTPEELVRLAIQHRPNFPPGDGWSYSNTNYILAAMIIHEVTGRSWAQEVNDRI
FT                   IRPLGLRDTSMPGAFPSILGPHAHSYAAFGTHTRTDVTVLNSSMAVGSGSIISTTHDLN
FT                   RFYTALLGGRLLAPAQLDEMTTTKPAPELGVRYGLGLGEIPLSCGGSYFGHPGELLGYR
FT                   TWGGVTRDGTRTAVVYVTSDGGRNTQQAMSTLVDQELCRTRS"
     atgcatgtgt taggaaggcg tcggcgaggc ccgctcgtcc tgaccggcct ggccgcggtt        60
     ctccttgccg cgtcgaccgg gctgacggcg gcggcgaagc cgcagcaggc cgatccgctc       120
     caacagcagg tggacgcgat ccacgacacc ggggccgtcg gtgtgctcgc cgaggtgacg       180
     tcaccggaca cacgtgacag cgcgcgcgcc gggacggccg agttgggcac cgggaggccg       240
     atgccacgga acggcagatt tcggatcggc agcgccgcca agaccttcac cgccacggtc       300
     gtgctgcaac tcgtcggcga ggggcgaatg tccctggagg acaccgtcga gcagtggctg       360
     ccgggagtgg tccggggtaa cgacaacgac ggcagccaga tcaccgtgcg gcagctgctg       420
     cagcacacca gcggcatccg tgacgtcctg ccggagatac ccgcgttgaa cagcgcggac       480
     ggctatcgag ccgagcggtt ccgcacctac acccccgagg agttggtgag gctggcgatt       540
     cagcaccgtc ccaacttccc cccgggcgac ggctggtcgt actccaacac caactacatt       600
     ctcgccgcga tgatcatcca cgaggtcacc ggccggagct gggcgcagga ggtgaacgac       660
     aggatcatcc gcccactggg cctgagggac accagtatgc ccggcgcctt cccgtccatc       720
     ctgggcccgc acgcccacag ctacgccgcg ttcggcaccc acacccgcac tgacgtcacg       780
     gtgctcaatt cgagtatggc cgtcggctcc ggttcgatca tcagcaccac gcacgacctg       840
     aaccggttct acaccgcact gctcggcggc cgtctgctgg ctccggcgca gctcgatgag       900
     atgacgacca ccaagcccgc gcccgagctg ggcgtgaggt acggactcgg cctgggcgag       960
     atcccgttgt cctgtggcgg cagctacttc ggccacccgg gcgaactgct cggctatcgc      1020
     acctggggtg gggtcacccg agacgggacc cggaccgccg tggtgtacgt caccagtgac      1080
     ggcggccgga acacccagca ggccatgagc acgctcgtgg accaggagct gtgccggacg      1140
     cgctcctag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page