(data stored in ACNUC7421 zone)

EMBL: CP002047.PE600

CP002047.PE600       Location/Qualifiers
FT   CDS_pept        complement(764587..765420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00600"
FT                   /product="ABC transporter related protein"
FT                   /note="COG1123 ATPase components of various ABC-type
FT                   transport systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03721"
FT                   /db_xref="GOA:D7C267"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C267"
FT                   /protein_id="ADI03721.1"
FT                   /translation="MAEQPTAISVRDVTRVYHRPRTSLRHPSPPVHALRGVSFTVPQGQ
FT                   RFGIVGESGCGKSTLLRILAGLDRPTSGSVAIDGRDITGLRERQLGFVRERLQLVFQDP
FT                   MSSLDPRMRVGDIVAEPLVAQGHSNRRERVAELLEAVGLRADAADRYPHQFSGGQRQRI
FT                   SIARALAPRPKIIVADEPVSALDVSVRAQVLNLIADLVEELSLTLVFVSHDLSVVRHVC
FT                   DRVAVMNGGQIVETGPTEQVYEEPQHSYTRRLIAAVPTLGKALSGVSAADLNREY"
     gtggctgagc agccgaccgc catcagcgtc cgcgacgtca cacgcgtcta ccaccgtccg        60
     cgtacctcgc tgcgccaccc cagccccccg gtgcacgccc tgcggggcgt cagcttcacc       120
     gtcccccagg ggcagcggtt cggcatcgtg ggggagtcgg ggtgcggtaa gtcgaccctg       180
     ctgcggattc tggccgggct cgaccgcccc accagcggta gcgtcgcgat cgacggccgg       240
     gacatcaccg ggctcaggga gagacagctc gggttcgtcc gcgagcggct tcaactcgtg       300
     ttccaggacc cgatgagttc gctggacccg cgtatgcgtg tcggtgacat cgtggccgag       360
     ccgctggtcg cacagggaca ctcgaaccgc cgggagcggg tggccgagtt gctcgaggcc       420
     gtcggcctgc gggccgacgc ggcggaccgg tatccgcacc agttctccgg cggccagcgg       480
     cagcgcatct cgatcgcgcg cgccctcgcc ccccgaccga agatcatcgt ggccgatgag       540
     ccggtgagcg ccctggatgt gtccgtacgg gcccaagtgc tcaacctcat cgccgacctc       600
     gtcgaggagc tgtccctcac gctggtcttc gtctcccacg acctgtccgt ggtccgccat       660
     gtgtgcgacc gggtcgcggt catgaacggc ggacagatcg tggagaccgg gcccacggag       720
     caggtgtacg aggagccgca acattcctac acacgcaggc tgatcgccgc cgtaccgacc       780
     ctgggcaagg cactgtccgg cgtgtcggcg gccgacctca accgggagta ctga             834
//

If you have problems or comments...

PBIL Back to PBIL home page