(data stored in ACNUC7421 zone)

EMBL: CP002047.PE601

CP002047.PE601       Location/Qualifiers
FT   CDS_pept        complement(765413..766456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00601"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03722"
FT                   /db_xref="GOA:D7C268"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7C268"
FT                   /protein_id="ADI03722.1"
FT                   /translation="MTGNVTGDVLAVRNLDVTVGGRKLVEDVGFTIGAGERVGLIGESG
FT                   SGKSLTALSVMGLLPEGLRATGSVRLAGVDHDLVGADEARMSRVRGKEIAMVFQEPMTA
FT                   LNPTMRVGRQIAEVLLIHRTRPDRASARAAAVELLAQVGLPDPAAAAQAYPHQFSGGQR
FT                   QRVVLAIALANDPALLVCDEPTTALDVTVQARVLDLIVRGVQDRRSAMLFITHDLAVVA
FT                   TACERVMVMYGGRLVESGPVQEVFTRPRHRYTQGLIGASDLTVVDDRGRLATIPGSVPP
FT                   AGQFPAGCVFRNRCAHATEACATRPEWVPTGPDSGYACFHPASESPASQSGAHVKGTPM
FT                   NQEAGRG"
     atgaccggca acgtgactgg cgacgtgctg gccgtgcgga acctcgacgt aacggtgggc        60
     ggccgtaagc tcgtcgaaga tgtcggcttc accatcgggg ccggcgagcg ggtcggcctg       120
     atcggcgagt cggggtcggg caagtcgctg accgcgctga gcgtcatggg cctgctcccc       180
     gaagggctcc gggccacggg ttcggtgcgg ctcgccggag tcgaccacga cctggtcggc       240
     gccgacgagg cgcggatgtc ccgggtgcgg ggcaaggaga tcgccatggt cttccaggag       300
     cccatgaccg ccctgaaccc cacgatgagg gtggggcggc agatcgccga ggtgctgctg       360
     atccaccgga ccaggcccga ccgggcctcc gcgcgagccg ccgccgtgga actgctcgcc       420
     caggtggggc tccccgaccc cgcggccgcc gcgcaggcat acccgcacca gttctccgga       480
     ggccagcggc agcgggtggt gctggccatc gccctcgcga acgaccccgc actcctggtc       540
     tgcgacgaac ccaccaccgc gctcgacgtc acggtgcagg cgcgggtgct cgacctgatc       600
     gtgcgcggtg tccaggaccg caggtcggcc atgctgttca tcacccacga cctggccgtg       660
     gtggccaccg cctgcgagcg ggtcatggtc atgtacggcg gacggctggt cgagtccgga       720
     ccggtccagg aggtgttcac ccgccctcgg caccgctaca cccagggcct gatcggcgca       780
     tcggatctga ccgtggtgga cgaccgcggc cggctggcca cgatccccgg atcggtaccg       840
     ccggcgggcc agttccccgc cggatgtgtc ttcagaaaca gatgtgccca cgcgaccgag       900
     gcgtgcgcca ccaggccgga atgggtcccg accgggccgg actccggcta cgcctgcttc       960
     cacccggcat ccgagagccc ggcatcccag agtggcgcgc acgtgaaggg cacacccatg      1020
     aaccaggagg ccggccgtgg ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page