(data stored in ACNUC7421 zone)

EMBL: CP002047.PE602

CP002047.PE602       Location/Qualifiers
FT   CDS_pept        complement(766453..767346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00602"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03723"
FT                   /db_xref="GOA:D7C269"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C269"
FT                   /protein_id="ADI03723.1"
FT                   /translation="MSAPDTKSAPDTKAAASAVPDVRRRRRPVTGSLLVGGLIVAVVLG
FT                   MALLSFVWTPHDPTLVNASARLQKPSLEYWFGTDKFGRDVFSQILVGSRTTLFVGFVAV
FT                   GVAAVVGVPLGIAAGMAPRWLGELLMRANDLLLAFPALLLAIMFAAVYGASTLVAMVAI
FT                   GIASIPNFARLIRGGTLQVMKTEYVTAARAAGRGPFAIAVRHVLPNVSSLVIVQASVGF
FT                   AIAVLAEAALSFLGFGTPPPTPSWGRMLQESQEMLSSAPRLAVFPGIAIAVAVLGFNLL
FT                   GDGLRDRFDPKLEDRR"
     atgagcgctc cggacaccaa gtccgctccg gacaccaagg ctgccgcgtc cgcggtgccc        60
     gacgtccgtc gtcggcgccg cccggtgacg ggcagcctgc tggtgggcgg tctcatcgtg       120
     gcggtcgtgc tcggcatggc gctgctgtcc ttcgtctgga cgccgcacga cccgaccctg       180
     gtgaacgcct cggcgcggct gcagaagccg tccctggagt actggttcgg cacggacaaa       240
     ttcggccgtg acgtgttcag ccagatcctg gtgggctcgc gtaccacgct gttcgtcggc       300
     ttcgtggcgg tgggggtcgc cgccgtggtc ggggtgcccc tcggcatcgc cgccgggatg       360
     gcgccccgct ggctcggcga gctgctgatg cgcgccaacg acctgcttct cgccttcccg       420
     gcgctcctgc tggccatcat gttcgccgcc gtgtacggcg ccagcacgct ggtcgcgatg       480
     gtcgccatcg gtatcgcgtc catccccaat ttcgcccggc tgatccgcgg cggcacgctg       540
     caggtcatga agaccgagta cgtcaccgcc gcgcgcgcgg cgggccgcgg gccgttcgcg       600
     atcgctgtgc ggcatgttct gcccaacgtc agcagtctcg tcatcgtgca ggcgtcggtc       660
     ggcttcgcca tcgccgtact cgccgaagcc gcactgtcct tcctgggctt cggcaccccg       720
     ccccccacac cgtcctgggg ccggatgctg caggagagcc aggagatgct gtcgtccgcc       780
     ccccggctcg ccgtgttccc gggcatcgcg atcgcggtgg cggtgctcgg attcaacctg       840
     ctcggtgacg gcctgcgcga ccgtttcgac cccaagctgg aggaccgcag atga             894
//

If you have problems or comments...

PBIL Back to PBIL home page