(data stored in ACNUC7421 zone)

EMBL: CP002047.PE603

CP002047.PE603       Location/Qualifiers
FT   CDS_pept        complement(767343..768293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00603"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00603"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03724"
FT                   /db_xref="GOA:D7C270"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7C270"
FT                   /protein_id="ADI03724.1"
FT                   /translation="MIVRLVQRIGILLASLVVSSVLVFAFMAVLPGDPARVALGVSASD
FT                   TAVAQLREQFGLDRPLVVQYFSWVKGLVTFDPGNSYISQTAIGPQIADRLQVTLWLVGA
FT                   GMALACILAIPMGTLMAVRHRKPSGLILSALSQVGVAVPAFLAGILLVTVFAVGLGWLP
FT                   ANGWTPPAQDPVMFLKQLVLPALSLGLVQGAMLTRYVRSAVLDVLREDYLRTARAKGLR
FT                   PTRALLRHGLRNAAVPVVTVLALHLATLLVGAVVIERVFVIPGLGSLLLDSVSNRDLIM
FT                   VQDVVMIIAMAVLLVNFLVDIIYLVIDPRLRAGAS"
     atgatcgtcc gtctggtgca gcggatcggg atcctcctgg ccagccttgt cgtgagctcc        60
     gtgttggtgt tcgcgttcat ggcggtgctg ccaggggatc cggcccgcgt cgccctcggc       120
     gtcagcgcgt cggacacggc ggtggcgcaa ctgcgcgagc agttcgggct cgaccggccg       180
     ctcgtggtcc agtacttcag ctgggtcaag ggactggtga ccttcgaccc gggtaactcc       240
     tatatctcac agacggcgat cggcccgcag atcgccgacc gcctccaggt caccctgtgg       300
     ctcgtcggcg ccgggatggc gctcgcctgc atcctggcga tccccatggg cacgctcatg       360
     gcggtgcggc accgcaagcc gtccgggctc attctctcgg ccttgtccca ggtcggcgtg       420
     gccgtcccgg ccttcctcgc gggcatcctc ctggtcaccg tgttcgcggt ggggctcggg       480
     tggctgccgg cgaacggctg gacacccccg gcgcaggatc cggtcatgtt cctcaaacag       540
     ctggtgctgc ccgcgctgtc cctcggactg gtgcaggggg ccatgctcac ccgctatgtc       600
     cgcagcgccg tgctcgatgt cctccgggag gactatctgc gcaccgcccg tgccaaagga       660
     ctccgtccga cgcgggcgct gctgcggcac ggcctgcgga acgcggcggt gcccgtggtc       720
     accgtcctgg cgttgcatct cgccacgctg ctggtgggcg ccgtggtcat cgaacgggtc       780
     tttgtcatcc ccgggctcgg gagcctgctg ctggacagcg tctccaaccg ggacctcatc       840
     atggtgcagg acgtggtcat gatcatcgca atggcggtgc tgctggtgaa cttcctggtg       900
     gacatcatct atctggtgat cgacccgcgg ctcagggcgg gtgcgtcatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page