(data stored in ACNUC7421 zone)

EMBL: CP002047.PE604

CP002047.PE604       Location/Qualifiers
FT   CDS_pept        complement(768310..769842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00604"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COG0747 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03725"
FT                   /db_xref="GOA:D7C271"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7C271"
FT                   /protein_id="ADI03725.1"
FT                   /translation="MRDNKQLTRHTGVVAATLASLLLAACSAGSTADGGGTGKSGKTDD
FT                   ALKIGLNAEPANLDITKTAGAAIPQALLYNVYENLVKVDQSGKIQPQLAKSWSLSKDRK
FT                   TYTFQLVKDAKFSSGAPFTAEDAKFSIERVKSDWTIAQKAQMDVVDTVQAVSPTELKVT
FT                   LKEPSNDWLYRMTTRVGVMFSRTGVSKLATEPVGTGPYVVKKWNRGDSITLARRDGYWG
FT                   SEPHFASVTLKYFKDPTAMNNALLTGTINVIGTMQTPDSLDRFANNSTYKVIEGTTNGE
FT                   VLLSLNNGSGPLKNLKARQAVRYAIDHKALLDTCWAGRGKLIGSMVPPTDPWYQDLTNQ
FT                   YPYDRDKAKKLLKESGVAGSTLRLRIPTLPYATACGTVVKSQLEQAGFKVTLDQLEFPA
FT                   AWLSTVFKNADYDMSIIGHLEPRDMQTVFGDKSYYTHYDNPEFRALLKKADKGTQEEQI
FT                   TAMRQAARLLSKDAAADWLFLLPNLMVADKDITGLPVDNVSESLDLTGLGRS"
     atgagagaca acaagcagct gacgcgacac accggggtgg tcgcggccac gctcgcatcc        60
     ctactgctgg cagcctgctc ggccgggtcc acggcagacg gaggtggcac gggcaagtcc       120
     gggaagaccg acgacgccct gaagatcggc ctcaacgccg agccggccaa cctcgacatc       180
     accaagaccg cgggcgccgc cattccccag gcactgctct acaacgtcta cgagaacctg       240
     gtgaaggtgg accagtccgg gaagatccag ccccaactgg ccaagtcgtg gagtctgtcc       300
     aaggaccgta agacatacac gttccagttg gtgaaggacg ccaagttcag cagtggcgca       360
     ccgttcaccg ccgaggacgc gaagttctcc atcgaacgcg tcaagtccga ctggacgatc       420
     gcgcagaagg cccagatgga cgtcgtcgac acggtgcagg cggtgtcacc gaccgaactc       480
     aaggtcaccc tgaaggagcc gagcaacgac tggctgtacc ggatgaccac ccgcgtcggc       540
     gtgatgttca gccggaccgg tgtgagcaag ctggccaccg agccggtggg caccggcccg       600
     tacgtggtga agaagtggaa ccgcggcgac tcgatcacgc tggcccgccg tgatggctac       660
     tgggggagtg aaccgcactt cgcgtcggtc accctcaagt acttcaagga cccgacagcc       720
     atgaacaacg cgctgctcac gggcaccatc aacgtgatcg gcacgatgca gaccccggat       780
     tctctggacc ggttcgcgaa caactcgacg tacaaggtca tcgagggcac gaccaacggc       840
     gaggtgctcc tctccctcaa caacggctcg ggcccgctga agaatctgaa ggcccgccag       900
     gccgtccgct acgccatcga ccacaaggcc ctgctggaca cctgctgggc ggggcgcggc       960
     aagctcatcg gcagcatggt cccgccgacc gacccgtggt accaggacct cacgaaccag      1020
     tatccgtacg accgcgacaa ggcgaagaag ctcctcaagg agtccggtgt ggccggcagt      1080
     acgctgcggc tgcggattcc gacgctgccc tatgccaccg cgtgcggcac cgtggtcaag      1140
     agccagctcg aacaggccgg gttcaaggtc accctcgatc agctggagtt ccccgccgcc      1200
     tggctgagca ccgtgttcaa gaacgccgac tacgacatgt ccatcatcgg acatctggaa      1260
     ccccgcgata tgcagacggt gttcggggac aagagctact acacccacta cgacaaccct      1320
     gaattccgcg cgttgctgaa gaaggcggac aagggcaccc aggaggagca gatcaccgcc      1380
     atgcggcagg ctgcccggct gctgtccaag gacgccgcgg ccgactggct gttcctgctg      1440
     ccgaacctga tggtggcgga caaggacatc accggcctgc ccgtggacaa cgtctccgag      1500
     tcactggatc tcaccggcct gggccggtca tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page