(data stored in ACNUC7421 zone)

EMBL: CP002047.PE606

CP002047.PE606       Location/Qualifiers
FT   CDS_pept        771072..772538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00606"
FT                   /product="amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00606"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03727"
FT                   /db_xref="GOA:D7C273"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D7C273"
FT                   /protein_id="ADI03727.1"
FT                   /translation="MLTEQGLATMPAVEMVAGFADHTLSPVQVHDAVQAVIEARESVLN
FT                   AFWVRDPDESRKAALASEARWAAGEPLGPIDGVPVTLKENVARRGVPMPSGNAGTVPVV
FT                   PEADAPITARVLESGGVVLGSTVMPDWGMLSSGVSSRHGITRSPWNPAWTTGGSSSGAG
FT                   AAAAGGYGPLHVGTDIGGSIRLPGTWLGLATLKPSYGRIPLDAPYLGRAAGPMARTVAD
FT                   AALFMSVLSRPDPRDWSSLPPQDINWSASAGEVRGLRVGVQLDAGCGEPCDAEVRAAVN
FT                   RAAALFEAAGAVVEPVEPFMSQDLLDDLDLFWRVRSWNDFRELPAEAKLRVHPSIIRWC
FT                   QGGADVPGTRVLQCYQQIMRIQERTVAATLPYDLVLSPVAPVAAFPAEQPMPFLEDAKT
FT                   MAHIGFTAPYNMSGQPAATVNCGLTADGRPIGVQLAGRRFDDLGVLRAAAWYEQNRPAE
FT                   AVPHWPDSAPGATTGATTGEKTTTLEGEKP"
     gtgctcaccg aacagggcct ggccaccatg ccggccgtcg agatggtggc cggattcgcc        60
     gaccacacgc tgtcgcccgt gcaggtccac gacgccgtcc aggcggtgat cgaggcgcgc       120
     gagagtgtgc tcaacgcgtt ctgggtgcgg gatccggatg agtcccgcaa agcggccctg       180
     gccagcgagg cgcgctgggc ggcgggggaa ccgctcgggc ccatcgacgg cgtgcccgtg       240
     acgctgaagg agaacgtcgc ccgcaggggc gtccccatgc cctcgggcaa cgcggggacc       300
     gtgccggtcg tccccgaggc ggacgcgccc atcaccgcgc gggtcctcga atccggtggg       360
     gtggtcctcg ggtcgaccgt gatgccggac tggggcatgc tctcctcggg agtctccagc       420
     cggcacggca ttacccgcag cccctggaac cccgcctgga ccacgggcgg ttccagctcc       480
     ggcgcggggg ccgcggcggc cgggggatac ggtccgctcc acgtcggcac cgacatcggg       540
     ggatcgatcc ggctgccggg cacctggctg gggctcgcca cgctcaagcc cagctacgga       600
     aggatcccgc tggacgcccc gtacctgggg cgcgccgccg gccccatggc gcgcaccgtg       660
     gcggacgcgg ccctgttcat gagtgtcctg agccggcccg atccccggga ctggtcgagt       720
     ctgccgccgc aggacatcaa ctggtcggcg tcggccggcg aggtgcgcgg actgcgggtg       780
     ggggtgcagc tggacgccgg ttgcggggag ccctgcgacg ccgaggtccg tgccgcggtg       840
     aaccgcgccg ccgcgctctt cgaggcggcg ggagccgtcg tggagccggt ggagccgttc       900
     atgagccagg atctcctgga cgatctggat ctgttctggc gggtgcggtc ctggaacgac       960
     ttccgcgaac tgccggccga ggccaagctg cgcgtccacc ccagcatcat ccgatggtgc      1020
     caggggggcg cggatgtgcc gggcacccgg gtgctccagt gctaccagca gatcatgcgt      1080
     atccaggagc ggaccgtggc ggcgacgctc ccgtacgatc tggtgctttc gccggtggct      1140
     ccggtggcgg cgttccccgc cgagcagccg atgccgttcc tggaagacgc gaagaccatg      1200
     gcccatatcg gcttcaccgc gccgtacaac atgtcgggcc agcccgcggc gaccgtcaac      1260
     tgcggtctga cggcggacgg tcggcccatc ggggtgcagc tcgcgggccg ccgattcgac      1320
     gatctcggtg tcctgcgggc ggcggcgtgg tacgaacaga accggcctgc cgaggcggtc      1380
     ccgcactggc cggacagcgc ccccggggcg accaccgggg cgaccaccgg ggagaagacg      1440
     acaacgctcg aaggggagaa gccgtga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page