(data stored in ACNUC7421 zone)

EMBL: CP002047.PE608

CP002047.PE608       Location/Qualifiers
FT   CDS_pept        complement(773318..776548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00608"
FT                   /product="putative methylmalonyl-CoA mutase"
FT                   /note="COG2185 Methylmalonyl-CoA mutase, C-terminal
FT                   domain/subunit (cobalamin-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03729"
FT                   /db_xref="GOA:D7C275"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D7C275"
FT                   /protein_id="ADI03729.1"
FT                   /translation="MNDLHRPVHPVRLVTASALFDGHDASINIMRRIFQSQGAEVIHLG
FT                   HNRSVREVVDAALEEDAHGVAVSSYQGGHVEYFEYLAASLRERGADHVRVVGGGGGVIV
FT                   PEEIARLRECGVTIFSPEDGQRLGLAGMVNSVVRDCDFDLWDRKPADAAAVLAGDRFAI
FT                   ARAITGAELGKLPPELLEQMRAAAAARVTPVLGITGTGGSGKSSLTDELVRRFRVDQHD
FT                   KLRIAVIAVDPTRRRGGGALLGDRIRMNSLDGHRVFFRSLATRGSRELPEQLSDVIDVV
FT                   KAAGFDLVVVETPGIGQGDAAIVPFVDTSLYVMTPEFGAASQLEKIDMLDFADVVAINK
FT                   FERRGAKDALRDVGRQLVRNREAFGMRPEDMPVYGTSAATFNDDGVTALYQYLRTALAE
FT                   RGLPLSEGTLPPVDVRHSSGIRQVVPTDRVRYLAEINETVRRYHEETERLAGAARRVQR
FT                   LDAVRGELVEAGSDAGSVQSLLEDARKQLPHDVTEQIGNWPTVVAAYSGDEQVVKVRDR
FT                   EIRTKLTRESLSGNKVPRVALPRFTDHGELVRFWRRENLPGYFPFTAGVFPFKRDGEDP
FT                   ARMFAGEGDPFRTNRRFKLLSEGQPATRLSTAFDSVTLYGRDPGERPDIYGKVGTSGVS
FT                   VATLEDMKALYDGFDLVAPTTSVSMTINGPAPTILAFFLNTAIDQQTERFRTAEGRDPS
FT                   PEEAARLRAHALASVRGTVQADILKEDQGQNTCLFSTEFSLRMMADIQEWFIAHKVRNF
FT                   YSVSISGYHIAEAGANPISQLAFTLANGFTYVEAYLARGMDIDDFAPNLSFFFSNGMDP
FT                   EYSVLGRVARRIWAVAMKEKYGANERSQKLKYHVQTSGRSLHAQEMDFNDIRTTLQALI
FT                   AIYDNCNSLHTNAYDEAVTTPTEDSVRRALAIQLIINREWGLAMNENPLQGSFIIDELT
FT                   DLVEAAVLAEFERISERGGVLGAMETGYQRGRIQDESMLYEQRKHDGTLPIIGVNTFRN
FT                   PRADTAEPGTIELARATEQEKESQLERVGDYQARHRDQAHAALMALKDAAVNGHNVFAV
FT                   LMDAARVCSLQQITEAFFEVGGQYRRNV"
     atgaacgatc tgcaccgccc tgtgcaccct gtccgcctgg ttacggcttc ggcgctgttc        60
     gacgggcacg atgcgtcgat caacatcatg cggcggatct tccagtccca gggcgccgag       120
     gtgatccatc tcgggcacaa ccgctccgtc cgcgaggtcg tggacgcggc gctcgaggag       180
     gacgcacacg gcgtcgcggt ctcctcctac cagggcggac atgtcgagta cttcgagtac       240
     ctggccgcgt cgctgcgcga gcggggagcg gaccacgtcc gcgtggtggg cggcggaggc       300
     ggtgtcatcg tgcccgagga gatcgcccga ctgcgcgaat gcggggtgac gatcttctcc       360
     cccgaggacg gccagcggct cggcctcgcc gggatggtca actcggtggt gcgggactgc       420
     gatttcgacc tctgggaccg caagccggcc gacgccgccg ccgtactcgc cggcgaccgg       480
     ttcgcgatcg cccgcgcaat caccggtgcc gaactcggca agctgccccc ggagctgctg       540
     gaacagatgc gtgccgccgc ggcggcgcgg gtcacaccgg tgctcggcat caccggcacc       600
     ggcggctcgg gaaagtcgtc actgaccgac gagctggtgc gccggttccg tgtggaccag       660
     cacgacaagt tgcggatcgc ggtgatcgcg gtcgacccga cccgccgccg tggcggcggt       720
     gcgctgctcg gtgaccggat ccggatgaac tccctggacg ggcaccgggt cttcttccgg       780
     agcctggcca cgcgcggcag ccgcgagctg cccgagcagc tgtccgatgt catcgacgtg       840
     gtcaaggcgg ccgggttcga tctggtggtc gtggagacac cgggcatcgg ccagggagac       900
     gcggcgatcg tgccgttcgt cgacacctcg ctgtatgtga tgacgccgga gttcggcgcc       960
     gcctcgcagc tggagaagat cgatatgctc gacttcgccg acgtggtggc catcaacaag      1020
     ttcgaacggc gcggcgccaa ggacgcactg cgtgatgtgg gccgccaact ggtccgcaac      1080
     cgcgaggcgt tcggtatgcg gcccgaggac atgccggtgt acggcacctc ggcggccacg      1140
     ttcaacgacg atggtgtcac cgcgctctac cagtatctga ggaccgccct ggccgagcgg      1200
     ggcctgcccc tgtccgaggg cacgctgccg ccggtcgacg tacgccactc ctcgggcatc      1260
     cggcaggtgg tgcccacgga ccgggtgcgc tatctcgccg agatcaacga gacggtccgc      1320
     cggtaccacg aggagaccga gcggctggcc ggggcggccc gtagggtgca gcgcctggac      1380
     gcggtcaggg gcgagctcgt cgaggccggc tccgacgccg ggagcgtgca gtcgctgctg      1440
     gaggacgccc gcaagcaact tccgcacgac gtcacggagc agatcgggaa ctggccgacc      1500
     gtcgtggccg cctactccgg tgacgagcag gtcgtgaagg tccgcgacag ggaaatccgt      1560
     accaagctga cccgcgagtc gctgtccggc aacaaggtcc cccgcgtcgc cctgcccagg      1620
     ttcaccgacc acggggagct ggtgcggttc tggcgccggg agaacctgcc cggctacttc      1680
     cccttcacgg ccggggtgtt cccgttcaaa cgcgacgggg aggacccggc gcggatgttc      1740
     gccggcgagg gcgatccgtt ccgtaccaac cggcgcttca agctgctctc cgagggccag      1800
     ccggccacgc ggctgtccac tgccttcgac tcggtcaccc tctatggccg tgaccccggc      1860
     gaacgccccg acatctacgg caaggtcggc acctccgggg tgtcggtggc cacgctggag      1920
     gacatgaagg ccctctacga cggcttcgac ctggtcgcgc cgacgacctc ggtctccatg      1980
     acgatcaacg gacccgcgcc gaccatcctg gcgttcttcc tgaacaccgc catcgaccag      2040
     cagaccgagc gattccgcac cgccgagggg cgtgacccgt cccccgagga ggccgcccgc      2100
     ttgcgcgcac acgcgctggc gagtgtgcgc ggcacggtgc aggccgacat cctcaaggag      2160
     gaccagggcc agaacacctg cctgttctcc accgagttct ccttgcggat gatggccgac      2220
     atccaggagt ggttcatcgc gcacaaggtc cgcaacttct actcggtgtc catctccggc      2280
     taccacatcg ccgaagccgg cgcgaacccc atcagccagc tggccttcac cctggccaac      2340
     ggcttcacct atgtcgaggc ctacctggcg cgcggtatgg acatcgacga cttcgccccg      2400
     aacctgtcct tcttcttctc caacggcatg gaccccgaat actccgtgct cggccgggtc      2460
     gcccgccgca tctgggcggt ggcgatgaag gagaagtacg gggcgaatga gcgcagccag      2520
     aagctgaagt accacgtcca gacctcaggc cgctccctgc acgcccagga gatggacttc      2580
     aacgacatcc gcaccacctt gcaggcgctc atcgccatct acgacaactg caacagcctg      2640
     cacaccaacg cctacgacga ggcggtgacc acccccactg aggactcggt ccgccgggcc      2700
     ctggccatcc agctgatcat caaccgggaa tggggcctgg cgatgaacga gaaccccctg      2760
     cagggctcgt tcatcatcga tgaactcacc gatctggtcg aggccgccgt gctcgccgag      2820
     ttcgagcgga tcagcgagcg cggcggtgtg ctcggcgcca tggagaccgg ctaccagcgc      2880
     ggccggatcc aggacgagtc gatgctgtac gagcagcgca agcacgacgg caccctgccg      2940
     atcatcggag tcaacacgtt ccgcaacccg cgcgcggaca ccgccgagcc cggcaccatc      3000
     gagctggcgc gcgccaccga gcaggagaag gagtcccagc tggagcgcgt gggcgactac      3060
     caggcccgcc accgcgacca ggcccacgcc gccctgatgg ccctcaagga cgcggcggtg      3120
     aacggccaca acgtcttcgc cgtcctcatg gacgccgccc gggtctgctc gcttcagcag      3180
     atcaccgagg cgttcttcga ggtcggcggc cagtaccggc gcaacgtctg a               3231
//

If you have problems or comments...

PBIL Back to PBIL home page