(data stored in ACNUC7421 zone)

EMBL: CP002047.PE612

CP002047.PE612       Location/Qualifiers
FT   CDS_pept        778910..780310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00612"
FT                   /product="integral membrane protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03733"
FT                   /db_xref="GOA:D7C279"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7C279"
FT                   /protein_id="ADI03733.1"
FT                   /translation="MSEAVVSPVRIGRLSIGALGALALALGTLQTVVDPALPLLQRELG
FT                   VSSGEGALVSNAVLITGAAVAPVAGKLGDRYGGKRVLVRLMAVVSAGGLLAGLAPNLPV
FT                   LLLGQVLQGAMVGALPLSFILVRKHLPAGESQLGMGLVMALFTGGGMVGTLTAGPIAEG
FT                   LSWHWMFALPTIAIIATTLVVARLMPHDPPIESEYGIDWPGVVLLSGTLLAFMLGLVRV
FT                   TGDDGLPPLTVGALAVVVAALATGWVVVERRAASPMVDLRMLAKPAMWHACMLTIVITT
FT                   SFGMVSFLLPQLFGVPGDGYGFGASTTDIGLFLLPGAIAGAVSDSVGGITARRFGLRAV
FT                   VVVGAVVTAATMTTLVSLHTAEWQLVLAKALAAMAAGVGTTALLTSAATAVETRDIGIA
FT                   TSVLVVTRVIGIALGVQIAAAILDAGADPTTGLPTESAFVTGFAVAGLVAALSLLVVRI
FT                   TKKKGAQA"
     atgtccgaag ctgtggtttc cccggtccgc atcgggaggc tgtcgatcgg cgccctcggc        60
     gccctggcac tcgccctcgg caccctgcag acagtggtgg atccagcgct cccgctgctg       120
     caacgtgagc tgggggtcag ctctggcgaa ggggcactgg tctccaacgc agtgctcatc       180
     accggcgccg ccgtcgcacc cgtcgcaggc aaacttggcg accgctacgg cggaaagcgg       240
     gtgctggtcc ggctgatggc cgtggtctcg gccggtggtc tgttggccgg cctggcgccg       300
     aacctgccgg tgttgttact cggtcaggta ttgcagggcg ccatggtggg tgcgctgccc       360
     ctttccttca tcctggtgcg caaacacctc ccggcagggg agtcacagct ggggatgggg       420
     ctggtcatgg cgctgttcac gggcggcggc atggtgggaa cgctcactgc cgggccgatc       480
     gcggaaggac tgtcctggca ttggatgttc gcgctgccga cgatcgcgat catcgcgacg       540
     acgttggtcg tggctcggtt gatgccgcat gatccgccga tcgaatcgga gtacgggatc       600
     gactggcctg gcgtggttct gctgagcggc acgttgctcg cgttcatgct cgggctcgtg       660
     agggtgacgg gcgacgacgg cctgccgcca ctcacggtcg gggccctcgc ggtggtcgtg       720
     gccgccctcg cgaccggatg ggtcgtcgtc gagcgccggg cagcctcgcc gatggtcgat       780
     ctacgcatgc tggcaaagcc tgcgatgtgg catgcgtgca tgctcaccat cgtcataacc       840
     accagtttcg ggatggtgag ctttctgctc ccacagctgt tcggggtacc gggcgacggg       900
     tacggcttcg gagccagcac caccgacatc ggactgttcc tgctgcccgg cgccatcgcc       960
     ggggcggtga gcgattcggt cggcgggatc acggcgcggc gtttcggtct gcgtgccgtg      1020
     gtcgtcgtgg gcgccgtcgt cacggcggcc acgatgacca ccctggtgtc gctgcacacc      1080
     gcggaatggc agctcgtcct cgcgaaggcg ctggccgcga tggccgcggg cgtcggtacc      1140
     acggcgttgc tcaccagcgc tgccaccgcc gtcgagacca gggacatcgg catcgccacc      1200
     agcgtgctcg tggtgactcg cgtaatcggc atcgccctgg gcgtccagat cgccgccgcg      1260
     atcctcgacg ccggggccga cccgacgacg ggcctgccta ccgaatcggc cttcgtcaca      1320
     ggtttcgccg tcgccggcct cgtcgccgca ctgtcactgc tcgttgtccg tatcacgaag      1380
     aaaaagggag cccaggcatg a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page