(data stored in ACNUC7421 zone)

EMBL: CP002047.PE614

CP002047.PE614       Location/Qualifiers
FT   CDS_pept        complement(781777..782457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00614"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family protein"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03735"
FT                   /db_xref="GOA:D7C281"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7C281"
FT                   /protein_id="ADI03735.1"
FT                   /translation="MLLADDQALLRGAFRMLLDSADDITVVGEAADGREAVRLTRELRP
FT                   DVVIMDIRMPEVDGLTATSEICADPELRASRILILTTYETDEYVAQALRAGAGGFIGKG
FT                   IGAEDLLDAVRTIADGDTLLSPAATRSLVARFLATPDDTPSHHPEQLAVLTPREREMVA
FT                   LVATGLSNQEIAERMFLSPFTVRAHVQRAMTKLEARDRAQLVVIAYRTGLAHAAPDGGT
FT                   GRLP"
     gtgctgctcg ccgacgatca ggccctgctg cgcggtgcct tccggatgct tctcgacagt        60
     gccgacgaca tcaccgtggt cggcgaggcc gccgacggca gggaggcggt gagactcacc       120
     cgggaactgc gcccggacgt ggtgatcatg gacatccgta tgcccgaggt ggacggtctc       180
     accgccacgt cggagatctg cgcggacccg gaactgcgtg ccagccgcat cctgatcctc       240
     accacgtacg agaccgacga gtacgtcgct caggcgctgc gcgcgggggc cggtggcttc       300
     atcggcaagg gaatcggggc cgaggacctg ctggacgccg tgcgtacgat cgccgacggc       360
     gacactctgc tgtcccccgc cgccacccgc tccttggtcg cccgcttcct ggccacaccg       420
     gacgacaccc cgtcgcacca ccccgaacag ctcgccgtgc tcacgccgcg cgaacgcgag       480
     atggtggccc tggtcgcgac cggcctgtcc aaccaggaga tcgccgagcg gatgttcctc       540
     agccccttca ccgtccgcgc ccatgtgcag cgcgccatga cgaagctgga ggcccgcgac       600
     cgggcgcaac tcgtcgtcat cgcctaccgg acgggcctgg cccacgcagc ccccgacggc       660
     ggcaccggcc gcctgccgta g                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page